Gene Information

Name : Ocepr_0547 (Ocepr_0547)
Accession : YP_004057178.1
Strain : Oceanithermus profundus DSM 14977
Genome accession: NC_014761
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 549447 - 550115 bp
Length : 669 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: msv:Mesil_0142 two component transcriptional regulator, winged helix family; PFAM: response regulator r

DNA sequence :
TTGGCCAAGATCCTGATCGTGGACGACGACCCGGCGATCCGGGAGATCCTCCGGGCCTACCTGAGCCACGAGGGCTACGA
ACTCAGCGAGGCGGCCGACGGGGTGAGCGCTCTGGCGCTCGCCCCCGCCGCCGACCTGGTGGTCCTCGACCTGATGCTGC
CCGAGATGGACGGGCTGGAGGTGGCGCGGCACCTGCGGCGCGACTTCCCCGAACTGCCCATCCTGATGCTGACGGCGCGC
GGCGAGGAGGAGGAGCGGGTGCGCGGCTTCGAAGAGGGCGCCGACGACTACGTGACCAAGCCCTTCAGCCCGCGTGAGCT
GGTGGCGCGGGTGCGCGCCCTGCTCAGACGTTCCGGCATCCACGACCGCCTCGTCTACGGCGATCTGGAGATCGTGCCGG
GGAGCCGCGAGGTCTACCTCGCGGGGCGGCCGGTGGAGCTCTCCAAGCTCGAGTTCGACCTGCTGCTCACGCTGGCGCAG
CACCCGGGCATGGTCTTCAGTCGCGAGCGGCTCCTGGAGCGCGTCTGGGGCAGCGACTTCTTCGGGGTCGAGCGCGTGGT
GGACGTGCACGTCGCCTCGCTGCGCAAGCGCCTGGGCGACGAGCCCGACCGGCCCCGTTTCATCGAGACGGTGCGCGGCG
TGGGGTATCGTTTCAAAGAGACGGAATGA

Protein sequence :
MAKILIVDDDPAIREILRAYLSHEGYELSEAADGVSALALAPAADLVVLDLMLPEMDGLEVARHLRRDFPELPILMLTAR
GEEEERVRGFEEGADDYVTKPFSPRELVARVRALLRRSGIHDRLVYGDLEIVPGSREVYLAGRPVELSKLEFDLLLTLAQ
HPGMVFSRERLLERVWGSDFFGVERVVDVHVASLRKRLGDEPDRPRFIETVRGVGYRFKETE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-21 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-21 44
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-10 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-18 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-26 46
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-24 45
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-30 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-25 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-14 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-25 43
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-28 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-28 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-18 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 9e-19 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 8e-19 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-19 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator BAC0039 Protein 9e-19 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-18 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-19 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 9e-13 42
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 1e-18 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 2e-18 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 2e-18 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-15 41
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 3e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-21 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator VFG1702 Protein 8e-22 44
Ocepr_0547 YP_004057178.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-25 42