Gene Information

Name : Ocepr_1581 (Ocepr_1581)
Accession : YP_004058207.1
Strain : Oceanithermus profundus DSM 14977
Genome accession: NC_014761
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1617630 - 1618337 bp
Length : 708 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829: IPR001789: IPR001867; KEGG: msv:Mesil_2637 two component transcriptional regulator, winged helix family; PFAM: response

DNA sequence :
ATGATGGAACACGACTACGAAGCCAGCGAACACATGGACGGACCGCTGATCCTCATCGTCGAAGACGAGAAGGACATCGC
CCGCTTCATCGAGCTCGAGCTCCAGGCCGAGGGTTACCGCACCGAGGTGGCGTACGACGGCATCACCGGCCTCTCCAAGT
TCCGCGAGACCAGCCCCAACCTGGTCATCCTCGACCTGATGCTGCCGGTCATGGACGGCCTCGAGGTGGCGCGGCGCATC
CGCAAGACCTCGAACATCCCCATCCTCATCCTCACCGCCAAGGACGCCGTCACCGACAAGGTCGAGGGCCTCGACGCCGG
CGCCGACGACTACCTGGTCAAGCCCTTCTCCATCGAGGAGCTGCTCGCCCGGGTGCGCGCCCACCTGCGCCGGGTCACCC
CGGCGATCACCGGCGAGATCCGCGTCGCCGACCTGATCATCAACCTCGAGGGGCGCGAGGTCTTCCGCGGCGGCCGCCGC
ATCGAGCTTTCCAACAAGGAGTTCGAGCTGCTCGAGCTGCTCGCCCGCAGCCCCGGCAAGGTCTTCAGCCGCTTCGAGAT
CGAGGAAAAGGTCTGGCCCGGCTACCAGGGCGGCTCCAACGTGGTCGACGTCTACATCGGCTACCTGCGCAAGAAGCTCG
AGGCCGAAGGCGAGCGCCGGCTGATCCACACCGTGCGCGGCGTCGGCTACGTGCTGCGCGAGGACTGA

Protein sequence :
MMEHDYEASEHMDGPLILIVEDEKDIARFIELELQAEGYRTEVAYDGITGLSKFRETSPNLVILDLMLPVMDGLEVARRI
RKTSNIPILILTAKDAVTDKVEGLDAGADDYLVKPFSIEELLARVRAHLRRVTPAITGEIRVADLIINLEGREVFRGGRR
IELSNKEFELLELLARSPGKVFSRFEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAEGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-31 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-27 42
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 2e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 52
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-39 50
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-40 49
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-34 47
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-31 46
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-36 45
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-33 45
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-33 45
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-32 44
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-29 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-35 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-34 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-27 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-31 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-32 42
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-31 41
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-30 41
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 4e-18 41
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-26 41
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-26 41
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-45 51
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-32 44
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-28 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-36 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-35 43
Ocepr_1581 YP_004058207.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-28 42