Gene Information

Name : Hbor_04370 (Hbor_04370)
Accession : YP_004035480.1
Strain : Halogeometricum borinquense DSM 11551
Genome accession: NC_014729
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 415190 - 415387 bp
Length : 198 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain

DNA sequence :
ATGAGTCAGACGCTCACTGTTGAGGGGATGAGTTGCGGCCACTGCGAACAGACCGTCGAAGACGCGCTCTCGAACGTTGA
TGGAGTCGAATCCGCCGCCGCCGACCACGAGTCTGCGTCCGTAACGGTACGGGGTGATGTCTCCGTGAACAAACTCGTCA
CTGCCGTCGAAGACGCTGGCTACGACGCCTCGGCGTAA

Protein sequence :
MSQTLTVEGMSCGHCEQTVEDALSNVDGVESAAADHESASVTVRGDVSVNKLVTAVEDAGYDASA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 5e-06 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 5e-06 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 5e-06 43
merP AGK07023.1 MerP Not tested SGI1 Protein 5e-06 43
merP AGK07081.1 MerP Not tested SGI1 Protein 5e-06 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 7e-06 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-06 41
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-05 41
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-06 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hbor_04370 YP_004035480.1 copper chaperone BAC0231 Protein 9e-07 43
Hbor_04370 YP_004035480.1 copper chaperone BAC0678 Protein 3e-06 41
Hbor_04370 YP_004035480.1 copper chaperone BAC0679 Protein 4e-06 41