|
Name : Hbor_04370 (Hbor_04370) Accession : YP_004035480.1 Strain : Halogeometricum borinquense DSM 11551 Genome accession: NC_014729 Putative virulence/resistance : Resistance Product : copper chaperone Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 415190 - 415387 bp Length : 198 bp Strand : + Note : PFAM: Heavy-metal-associated domain DNA sequence : ATGAGTCAGACGCTCACTGTTGAGGGGATGAGTTGCGGCCACTGCGAACAGACCGTCGAAGACGCGCTCTCGAACGTTGA TGGAGTCGAATCCGCCGCCGCCGACCACGAGTCTGCGTCCGTAACGGTACGGGGTGATGTCTCCGTGAACAAACTCGTCA CTGCCGTCGAAGACGCTGGCTACGACGCCTCGGCGTAA Protein sequence : MSQTLTVEGMSCGHCEQTVEDALSNVDGVESAAADHESASVTVRGDVSVNKLVTAVEDAGYDASA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 5e-06 | 43 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 7e-06 | 43 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 5e-06 | 43 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 5e-06 | 43 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 5e-06 | 43 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 5e-06 | 43 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-06 | 41 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-06 | 41 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 1e-05 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Hbor_04370 | YP_004035480.1 | copper chaperone | BAC0231 | Protein | 9e-07 | 43 |
| Hbor_04370 | YP_004035480.1 | copper chaperone | BAC0679 | Protein | 4e-06 | 41 |
| Hbor_04370 | YP_004035480.1 | copper chaperone | BAC0678 | Protein | 3e-06 | 41 |
