Gene Information

Name : RBRH_02687 (RBRH_02687)
Accession : YP_004029215.1
Strain : Burkholderia rhizoxinica HKI 454
Genome accession: NC_014722
Putative virulence/resistance : Resistance
Product : cadmium resistance regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1426911 - 1427342 bp
Length : 432 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATTGGCGAATTGGCAAAGCGGGTCGGATGCACGCCTGAAACGGTCCGTTTCTACGAGAAAGAAGGGTTGCTGCC
GATGGCAGCGCGCACAGGCGCCAATTACCGCGCCTATGGTGAAGCGCATTTGGACCGGTTGCGCTTCGTGCGCAACTGTC
GGGCACTGGACATGACGCATGACGAGATTCGCGTGTTGTTGCAGGCCGCGGATGCCCCGGCGCGCGATTGTGGCGCGATC
GATGCGTTGGTCGATGAACATTTGCGGCACGTCAACATGCGAATCGACGAGTTACAGCAGTTGCGCGCACAATTGAGCGC
GCTCCGCGAACGGTGTCGTGGCGCAAGATCCGTCCAGGATTGCGGCATTATGCGCGGCTTGGCGGCCATGGACAGCCCTG
CCCATGTCCCCAAGCAGACTCATCTGGGCTGA

Protein sequence :
MKIGELAKRVGCTPETVRFYEKEGLLPMAARTGANYRAYGEAHLDRLRFVRNCRALDMTHDEIRVLLQAADAPARDCGAI
DALVDEHLRHVNMRIDELQQLRAQLSALRERCRGARSVQDCGIMRGLAAMDSPAHVPKQTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 1e-26 52
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 5e-25 45
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 6e-25 45
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 8e-25 45
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-25 45
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 5e-25 45
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 3e-25 45
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 3e-25 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RBRH_02687 YP_004029215.1 cadmium resistance regulatory protein BAC0301 Protein 4e-30 57
RBRH_02687 YP_004029215.1 cadmium resistance regulatory protein BAC0058 Protein 6e-29 51