|
Name : RBRH_01875 (RBRH_01875) Accession : YP_004022508.1 Strain : Genome accession: NC_014718 Putative virulence/resistance : Resistance Product : Quaternary ammonium compound-resistance protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 587996 - 588328 bp Length : 333 bp Strand : - Note : Quaternary ammonium compound-resistance protein; COG: Membrane transporters of cations and cationic drugs; Pfam: Small Multidrug Resistance protein::PF00893 DNA sequence : ATGCTTGCCTACTTGTATCTCGCGATTGCAATCGTCGCCGAAGTGATCGGCACGTCGGCGCTCAAGGCGTCCGATGGTTT TACGCGGCTGCTGCCGTCGGTGATCACTGCGCTCGGCTACGCGGTCGCGTTCTACTGCCTGTCCCTGACGTTGCGTTCGG TGTCGGTCGGCATTGCCTATGCGATCTGGTCGGGAGTCGGCATTGTATTGATTTCGCTGGTTGCGTTCTTCGTCTACGAT CAGCGGCTCGATTGGCCGGCGGTGACCGGCATGGGGTTCATCGTCGCCGGCGTCGTGTTGATGAACGGCTTTTCGAAGAC CGCTGCTCACTAG Protein sequence : MLAYLYLAIAIVAEVIGTSALKASDGFTRLLPSVITALGYAVAFYCLSLTLRSVSVGIAYAIWSGVGIVLISLVAFFVYD QRLDWPAVTGMGFIVAGVVLMNGFSKTAAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 9e-18 | 52 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-18 | 52 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-18 | 52 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 1e-17 | 52 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 9e-18 | 52 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 9e-18 | 52 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-18 | 52 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-17 | 52 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-18 | 52 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-17 | 52 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-18 | 52 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 1e-17 | 52 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 9e-18 | 52 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-18 | 52 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-18 | 52 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 1e-17 | 52 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0377 | Protein | 6e-26 | 61 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0002 | Protein | 2e-20 | 59 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | NC_010410.6003348.p0 | Protein | 2e-20 | 59 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0324 | Protein | 1e-20 | 57 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0322 | Protein | 2e-21 | 56 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | NC_002695.1.913273.p | Protein | 2e-16 | 56 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0150 | Protein | 2e-16 | 55 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | CP001138.1.gene1489. | Protein | 6e-22 | 54 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | CP004022.1.gene1549. | Protein | 9e-21 | 53 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0323 | Protein | 4e-18 | 52 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0192 | Protein | 4e-15 | 46 |
| RBRH_01875 | YP_004022508.1 | Quaternary ammonium compound-resistance protein | BAC0325 | Protein | 3e-12 | 42 |
