Gene Information

Name : FraEuI1c_0969 (FraEuI1c_0969)
Accession : YP_004014912.1
Strain : Frankia sp. EuI1c
Genome accession: NC_014666
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1208381 - 1208956 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: fal:FRAAL5898 tellurium resistance protein TerE

DNA sequence : 
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTCTCGTTGTCGAAGGAGGCACCTGGCCTCACGAGCATCATGGTCGGTCT
CGGCTGGGACGCTCGGACGACGACCGGTTCGGACTTCGACCTCGACGCGAGCGCGATTGCGTGCCGCGCCGACGGTCGGG
TGGTCTCCGACCAGTACTTCGTCTTCTTCAACAATCTGCGTAGCCCGGATGGCGCGATCGAGCACCAGGGCGACAACCTC
ACCGGCGCCGGCGAGGGTGACGACGAGCAGGTGAAGGTCAACCTCGCCACCCTGCCGGCCGAGATCGACAAGATCGTGTT
CCCGGTCTCGATCTACGACGCCGAGTCGCGGCAGCAGAGCTTCGGCCAGGTGCGCAACGCGTTCATTCGCATCGCGAACG
AGGTCGGCGGCGCCGAGATCGCCCGGTACGACCTGTCCGAGGACGCCTCGACCGAGACCGCCATGATCTTCGGTGAGGTC
TACCGGCACGGCGCCGACTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCGACCGGCCTGCGCGGCATCGCTCAGGACTA
CGGCGTCAACGTTTAA

Protein sequence : 
MGVSLSKGGNVSLSKEAPGLTSIMVGLGWDARTTTGSDFDLDASAIACRADGRVVSDQYFVFFNNLRSPDGAIEHQGDNL
TGAGEGDDEQVKVNLATLPAEIDKIVFPVSIYDAESRQQSFGQVRNAFIRIANEVGGAEIARYDLSEDASTETAMIFGEV
YRHGADWKFRAVGQGYATGLRGIAQDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-60 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-56 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-56 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-57 62
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-57 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FraEuI1c_0969 YP_004014912.1 stress protein BAC0390 Protein 1e-58 62
FraEuI1c_0969 YP_004014912.1 stress protein BAC0389 Protein 8e-57 62