Gene Information

Name : Rvan_2354 (Rvan_2354)
Accession : YP_004012677.1
Strain : Rhodomicrobium vannielii ATCC 17100
Genome accession: NC_014664
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2570179 - 2570871 bp
Length : 693 bp
Strand : +
Note : KEGG: xau:Xaut_3176 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence : 
ATGCGCATTCTCGTGGTTGAGGACGACGTGGATTTGAGCCGCCAGCTTGTCGCGGCGATGACCGACGCGGGCTATGCGGC
CGACGCCGCCTTCGATGGCGAGGAAGGCGCGTGGCTCGGCGAGACTGAGCCATACGACGCCATCATCCTCGATCTCGGCC
TTCCCAAGATCGACGGGCTGTCCATTCTCGAACGCTGGCGCAAGGCGGACATCAAGACGCCCGTGCTCATCCTCACCGCG
CGCGACCGCTGGAGCGAGAAAGTTGCGGGCATCAACGCGGGCGCGGATGATTATGTCGCCAAGCCCTTCCAGATGGAGGA
GGTGATCGCCCGCATCCGCGCGTTGCTGCGCCGGAGCGCTGGCGTGGCCAAGGCCGAACTGGAATGCGGCGATCTGCGGC
TCGATACCCGCACGGCGCGCGTAACCTGGAAGGGCACGGCGGTGAAGCTGACCGGCCTCGAATTCCGGCTCCTCTCCTAT
CTGATGCACCATCAGTCCCGCGTCGTCTCGCGAACCGAACTCGTGGACCACCTTTACCAGCAGGATTTCGAGCGCGATTC
GAACACCATCGAGGTCTTCATCGGCAGGCTGCGCCGCAAGATTCCCGCCGACATCATCCACACGGTGCGCGGGCTCGGCT
ATTGCCTCTCAGCCGCCGTCGATCCCGAAGGGAGCGCGAAGAAGGGCTCATGA

Protein sequence : 
MRILVVEDDVDLSRQLVAAMTDAGYAADAAFDGEEGAWLGETEPYDAIILDLGLPKIDGLSILERWRKADIKTPVLILTA
RDRWSEKVAGINAGADDYVAKPFQMEEVIARIRALLRRSAGVAKAELECGDLRLDTRTARVTWKGTAVKLTGLEFRLLSY
LMHHQSRVVSRTELVDHLYQQDFERDSNTIEVFIGRLRRKIPADIIHTVRGLGYCLSAAVDPEGSAKKGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 6e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-31 45
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 5e-32 44
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 2e-31 44
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator BAC0530 Protein 5e-32 44
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 1e-31 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 3e-32 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 2e-32 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 7e-35 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-25 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator BAC0487 Protein 1e-26 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-23 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-25 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator VFG0475 Protein 2e-32 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-25 43
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-22 42
Rvan_2354 YP_004012677.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-22 41