Gene Information

Name : Rvan_1791 (Rvan_1791)
Accession : YP_004012132.1
Strain : Rhodomicrobium vannielii ATCC 17100
Genome accession: NC_014664
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1959877 - 1960230 bp
Length : 354 bp
Strand : -
Note : KEGG: rsq:Rsph17025_3725 hypothetical protein; manually curated; PFAM: IS66 Orf2 family protein

DNA sequence :
GTGATTTTCGGCGCCATTCCACCTCGGATTTACATCGCGACGCGGCCTGTCGATTTCAGGAAAGGCATGGATGGGCTTGC
GGCCACGGTTCAGGAGGTCTTGAAGCTCGATCCGTTTTGCGGCGCTGCCTTCATCTTCCGCTCCAAGCGGGCGGACCGGA
TCAAGATTTTGATCTGGGATGGCTCGGGGCTGATCCTGATCTACAAGCGGCTCGAGGATGCGAAGTTCCGCTGGCCAAGG
ATCGAGGACGGGGTCATGCGTCTGTCGCCTGCGCAAGCGTCCGCCTTGTTCGAGGGCTTGGACTGGGCCCGGGTCCGTGC
GGTTCGAAGGGCGCGTCCTCAGGCGGTGCAATAA

Protein sequence :
MIFGAIPPRIYIATRPVDFRKGMDGLAATVQEVLKLDPFCGAAFIFRSKRADRIKILIWDGSGLILIYKRLEDAKFRWPR
IEDGVMRLSPAQASALFEGLDWARVRAVRRARPQAVQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-19 52
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-18 50
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-18 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-17 49
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-15 46
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-15 46
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-14 45
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-14 45
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-14 45
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-14 45
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-14 45
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-14 45
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-14 45
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-14 45
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-14 45
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-14 45
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-14 44
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-14 44
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-16 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-16 44
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-14 44
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-16 43
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-15 42
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-15 42
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 8e-10 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rvan_1791 YP_004012132.1 IS66 Orf2 family protein VFG1665 Protein 7e-18 49
Rvan_1791 YP_004012132.1 IS66 Orf2 family protein VFG1698 Protein 1e-15 46
Rvan_1791 YP_004012132.1 IS66 Orf2 family protein VFG1709 Protein 5e-15 45
Rvan_1791 YP_004012132.1 IS66 Orf2 family protein VFG0792 Protein 5e-15 45
Rvan_1791 YP_004012132.1 IS66 Orf2 family protein VFG1052 Protein 1e-14 44
Rvan_1791 YP_004012132.1 IS66 Orf2 family protein VFG1737 Protein 2e-16 43