Gene Information

Name : arsC2 (REQ_11890)
Accession : YP_004005972.1
Strain : Rhodococcus equi 103S
Genome accession: NC_014659
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 1238146 - 1238502 bp
Length : 357 bp
Strand : -
Note : -

DNA sequence :
ATGGCAGGTACCGCAAAGAACGCAACGATCTATCACAATCCCCGCTGCAGCACGTCGCGGAACACGTTGAAACTCATCGA
GGAAGCCGGCCTCGAGCCGACCGTCGTCAAGTACCTCGAGACGCCGCCTTCGCGGGACGGACTGCGCAAACTGCTCGACG
AGGCGGGCCTGCGCCCGAGCGAGGCGATCCGAAAGAAGGAGGCCGTCTACAAGGAACTCGGCCTCGCGAGCGCCTCCGAG
GACGAACTGCTCGACGCGATGGTCGACAACCCGATCCTCATCGAACGCCCCATCGTCGTGACCGACCGCGGCACCGTGCT
GGCGCGGCCGTACGAGAAGGTGCGCGACATCCTCTGA

Protein sequence :
MAGTAKNATIYHNPRCSTSRNTLKLIEEAGLEPTVVKYLETPPSRDGLRKLLDEAGLRPSEAIRKKEAVYKELGLASASE
DELLDAMVDNPILIERPIVVTDRGTVLARPYEKVRDIL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 3e-23 58
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 8e-24 51
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 7e-24 51
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 5e-24 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsC2 YP_004005972.1 arsenate reductase BAC0583 Protein 5e-25 58
arsC2 YP_004005972.1 arsenate reductase BAC0584 Protein 6e-24 56
arsC2 YP_004005972.1 arsenate reductase BAC0582 Protein 1e-23 55
arsC2 YP_004005972.1 arsenate reductase BAC0585 Protein 2e-23 54