Gene Information

Name : REQ_11640 (REQ_11640)
Accession : YP_004005948.1
Strain : Rhodococcus equi 103S
Genome accession: NC_014659
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1218063 - 1218749 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATATTGGTGGTCGACGACGACCGGGCGGTGCGGGAGTCGCTGCGGCGATCCCTGAGCTTCAACGGCTACACGGT
CGATCTCGCCGTCGACGGCATGGATGCGCTCGAGAAGGTCGCGGCGTCGCGCCCCGATGCGCTCGTGCTCGACGTGATGA
TGCCGCGCCTGGACGGACTCGAGGTGTGCCGCCGACTGCGCAGCACCGGCGACGATCTGCCGATTCTCGTTCTCACCGCC
CGTGATTCGGTGTCCGAGCGGGTCGCCGGCCTGGACGCCGGTGCCGACGACTACCTGCCCAAGCCGTTCGCGCTCGAGGA
GTTGCTCGCCCGTCTGCGCGCCCTGCTGCGCCGGGCTGCGCCGGCCGCCGGGGACGACTCCGAGGCCATGACGTTCGAGG
ACCTCACGCTGGACCCGGTGACCCGCGAGGTGACCCGCGGCGGTCGCTCGATCAGCCTCACCCGCACCGAGTTCGCGCTG
CTCGAGATGCTGATGGCGAACCCGCGCCGGGTGTTGTCCCGCAGCCGCATCCTCGAGGAGGTGTGGGGTTACGACTTCCC
GACGTCGGGCAATGCGCTCGAGGTGTACGTCGGCTACCTGCGGCGCAAGACCGAGGCCGACGGTGAGCCGCGCCTGATCC
ACACGGTGCGCGGTGTCGGTTACGTCCTGCGGGAGACGCCTCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYTVDLAVDGMDALEKVAASRPDALVLDVMMPRLDGLEVCRRLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARLRALLRRAAPAAGDDSEAMTFEDLTLDPVTREVTRGGRSISLTRTEFAL
LEMLMANPRRVLSRSRILEEVWGYDFPTSGNALEVYVGYLRRKTEADGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
REQ_11640 YP_004005948.1 two component system response regulator BAC0083 Protein 4e-35 49
REQ_11640 YP_004005948.1 two component system response regulator BAC0638 Protein 5e-29 47
REQ_11640 YP_004005948.1 two component system response regulator BAC0125 Protein 2e-33 45
REQ_11640 YP_004005948.1 two component system response regulator HE999704.1.gene1528. Protein 1e-36 45
REQ_11640 YP_004005948.1 two component system response regulator BAC0111 Protein 1e-34 45
REQ_11640 YP_004005948.1 two component system response regulator AE000516.2.gene3505. Protein 3e-33 44
REQ_11640 YP_004005948.1 two component system response regulator BAC0347 Protein 1e-29 43
REQ_11640 YP_004005948.1 two component system response regulator BAC0197 Protein 3e-30 43
REQ_11640 YP_004005948.1 two component system response regulator NC_007793.3914065.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_002758.1121390.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_010079.5776364.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_002952.2859858.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_007622.3794948.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_003923.1003417.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_013450.8614146.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator NC_002951.3238224.p0 Protein 5e-34 42
REQ_11640 YP_004005948.1 two component system response regulator U82965.2.orf14.gene. Protein 9e-23 42
REQ_11640 YP_004005948.1 two component system response regulator AE015929.1.gene1106. Protein 3e-30 41
REQ_11640 YP_004005948.1 two component system response regulator NC_002516.2.879194.p Protein 3e-23 41
REQ_11640 YP_004005948.1 two component system response regulator BAC0308 Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
REQ_11640 YP_004005948.1 two component system response regulator VFG1390 Protein 4e-83 88
REQ_11640 YP_004005948.1 two component system response regulator VFG1389 Protein 5e-44 53
REQ_11640 YP_004005948.1 two component system response regulator VFG1386 Protein 7e-45 52
REQ_11640 YP_004005948.1 two component system response regulator VFG0596 Protein 9e-32 43