Gene Information

Name : Calow_0190 (Calow_0190)
Accession : YP_004001596.1
Strain : Caldicellulosiruptor owensensis OL
Genome accession: NC_014657
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 233351 - 234004 bp
Length : 654 bp
Strand : -
Note : KEGG: amt:Amet_3209 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
TTGAAGATACTGCTGATTGAAGATGAAGAAAAGCTCAGAAAAATAATAAAGTTATATCTTGAAAAAGAAGGGTTTGAAGT
AAAAGAAGCATCGGATGGAAACGAAGCAATTGAAAAATTTCAGCCTTCAATGTACTCTGTTGTGATCTTAGATGTGATGC
TGCCTCAAAAAGATGGCTGGAGTGTGTTAAGAGAAATAAGGAAAAAGGACGATACGCCAGTTATTATGCTAACAGCTCGT
GGAGAGGATGATGATAAGATATTTGGATTTGAACTTGGTGCTGATGACTATGTTGTAAAGCCTGTAAGCCCCAAGGAGAT
TGTTGCACGTGTAAAGGCAATTTTAAAGAGAAGTAAAAAATCTAGTTCAGACGAGATTCTGTTCATTGATAAAGCAGCAC
GAGAGGTATATGTAAAAGGTCAAAAATTAAATCTTACCCAAAAAGAATATGAACTTCTATTGTATTTATACGAAAGACAA
AATATTGCTCTTTCAAGAGAACAGATTTTAAACAGTGTATGGGGCTACGAATATTACGGTGACCTCAGAACTGTGGATAC
ACATATTAAAAACTTGCGCGAAAAACTTGGTGAACTCAGAGATTATATAAAAACAGTAAGAGGATACGGATATAAATTTG
AGGTGAAAAAATGA

Protein sequence :
MKILLIEDEEKLRKIIKLYLEKEGFEVKEASDGNEAIEKFQPSMYSVVILDVMLPQKDGWSVLREIRKKDDTPVIMLTAR
GEDDDKIFGFELGADDYVVKPVSPKEIVARVKAILKRSKKSSSDEILFIDKAAREVYVKGQKLNLTQKEYELLLYLYERQ
NIALSREQILNSVWGYEYYGDLRTVDTHIKNLREKLGELRDYIKTVRGYGYKFEVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-35 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 4e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-36 48
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 1e-34 43
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 1e-34 43
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 1e-35 43
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-26 43
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-36 43
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-34 42
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 6e-23 42
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 1e-35 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 9e-25 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-25 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 5e-29 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 2e-28 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 5e-29 41
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 7e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calow_0190 YP_004001596.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-22 43