Gene Information

Name : Calow_1266 (Calow_1266)
Accession : YP_004002624.1
Strain : Caldicellulosiruptor owensensis OL
Genome accession: NC_014657
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1349365 - 1350063 bp
Length : 699 bp
Strand : -
Note : KEGG: ate:Athe_1487 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAAAAACATTTTAATAGTTGATGATGAGCAGCATATTCTTGAACTTCTCAAATTTAATCTTAGGAAAGAAGGATACAA
TACATTTGAAGCGGACAGTGGAGTACAGGCATTGGAGATTTTAAAGAATAGCAAAGTTGATCTTGTCATACTTGATATTA
TGATGAGTGACAAGGATGGATATGAAATTTTAAAAGAGATTCGATTCAATAGAGATACTAAAAATCTTCCGGTGATTTTG
CTGTCTGCTAAATCTGAAGAGATTGATAAGATACTTGGGCTTGAGCTCGGAGCAGATGACTATATAACAAAGCCTTTTAG
TGTAAAAGAGCTGGTTGTAAGAGTGAAGGCGCTTTTAAGAAGAGTAGAGAGTTTAAAGCCTGAGGTTGAAGATAAGGTCA
AGTTTGGAGATGTAGAAGTGGACTTTTCAAAAAGAACTGTCAAGAAAAATAACCAGGATGTATCTCTTTCGTTCAAAGAG
TTTGAGCTTCTGAAGCTTCTTATCGAAAACAAAGGCAGGGTGTTGGACAGAGACTTTATTTTGCAAAGGGTATGGGGATA
CGAGTTTGATGGAGATACACGAACGGTTGATGTACACATAAGGTTTTTGAGGAGAAAACTTGAAGATGATGAGAAAAATC
CGCGTTACATAGAAACTGTCAGGGGTGTGGGATACAGGTTTAATGAAAGGTCTGAGTAA

Protein sequence :
MKNILIVDDEQHILELLKFNLRKEGYNTFEADSGVQALEILKNSKVDLVILDIMMSDKDGYEILKEIRFNRDTKNLPVIL
LSAKSEEIDKILGLELGADDYITKPFSVKELVVRVKALLRRVESLKPEVEDKVKFGDVEVDFSKRTVKKNNQDVSLSFKE
FELLKLLIENKGRVLDRDFILQRVWGYEFDGDTRTVDVHIRFLRRKLEDDEKNPRYIETVRGVGYRFNERSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-23 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 7e-36 49
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 8e-36 49
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 8e-36 49
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 9e-36 48
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-33 47
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-31 46
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-35 45
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-32 44
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 6e-31 44
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-32 43
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-31 43
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 1e-23 41
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-22 41
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 7e-28 41
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 7e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-24 44
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-25 41
Calow_1266 YP_004002624.1 two component transcriptional regulator, winged helix family VFG1386 Protein 5e-31 41