Gene Information

Name : Lbys_0791 (Lbys_0791)
Accession : YP_003996903.1
Strain : Leadbetterella byssophila DSM 17132
Genome accession: NC_014655
Putative virulence/resistance : Unknown
Product : is66 orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 846635 - 846928 bp
Length : 294 bp
Strand : +
Note : InterPro IPR008878; KEGG: zpr:ZPR_3984 transposase orf1, IS66 family protein; PFAM: IS66 Orf2 family protein; SPTR: Transposition helper protein; PFAM: IS66 Orf2 like protein

DNA sequence :
ATGTTTTCATTAGGTTCTTGGCACCGTTTTTATTTATATGATGGCCATTGCGATATGCGAAAATCATTCGATGGGCTTTG
TGGATTGGTTGTTTCGGTGATGCAACGCCAGCCTACCAGCGGCGAAGTGTTCGTTTTCCTGAACCGTAGCCGTACCCACA
TCAAACTGCTACACTGGGAGCGAGGCGGCTTTGTGCTCTACTACAAACGATTGGAGCAGGGTACTTTTGGTAGATCTGCA
CTTAAAAAAGGAGAAGTACTCCCCATATCTTGGACAGCATTTATTCAATATTAA

Protein sequence :
MFSLGSWHRFYLYDGHCDMRKSFDGLCGLVVSVMQRQPTSGEVFVFLNRSRTHIKLLHWERGGFVLYYKRLEQGTFGRSA
LKKGEVLPISWTAFIQY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-09 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-09 44
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-08 42
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-08 42
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-09 42
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-09 41
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 8e-10 41
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-10 41
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-10 41
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-10 41
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-10 41
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-10 41
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-10 41
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 8e-10 41
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 8e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lbys_0791 YP_003996903.1 is66 orf2 family protein VFG1737 Protein 1e-09 42
Lbys_0791 YP_003996903.1 is66 orf2 family protein VFG1517 Protein 3e-09 41
Lbys_0791 YP_003996903.1 is66 orf2 family protein VFG1709 Protein 2e-10 41
Lbys_0791 YP_003996903.1 is66 orf2 family protein VFG0792 Protein 2e-10 41
Lbys_0791 YP_003996903.1 is66 orf2 family protein VFG1052 Protein 2e-10 41