Gene Information

Name : Halsa_0373 (Halsa_0373)
Accession : YP_003994202.1
Strain : Halanaerobium hydrogeniformans sapolanicus
Genome accession: NC_014654
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 435262 - 435957 bp
Length : 696 bp
Strand : +
Note : KEGG: tjr:TherJR_1220 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAATAAAAAAAAGGTTTTAATCATAGATGATGATCCACATATAAGAGAAATACTGGATGACTACTTAAATTTTGAGGG
TTTTGATGCCTTTTTAGCAGAAGATACCGAAAAGGGATTGAAAATACTGCAGGAAGAAAAAGTAGATATTTTGATCCTCG
ATATAATGCTTCCTGATGAAGATGGCTGGGAGTTTTGTCAGAAGATAAGACCGGAATATGATCTGCCGATCATATTTTTA
AGTGCCAAAGATAAATCGGTTGACAAAATAACCGGCTTAGAGCTGGGTGCAGATGATTATATAACCAAACCCTTTAGCCC
CAGAGAGGTTGTTGCCAGAATAAAAGCTGTTTTGAGAAGATATAATAAAGCAGCAGAAAATGCAAAGATCATTAAATATG
GGGAACTGATAATTAACCGTGAACAGCATCTAGTGAGTTTTCAGGGAGAAAAGATAGAACTGACTCCTAAAGAGTTTTCA
CTACTCTGGCACCTGGCTGAAAACCCCAAAAAAGTTTTTAGAAGAGAAAGGCTGCTTAAAGCTGTCTGGGGTTATGATTA
TTATGGTGATGTTCGCACGGTAGATACCCATATCAAATCTCTGCGCAAAAAACTGGGTGATAAAGCAGCAGAGGCAGTTG
AAACTGTCTGGGGGGTGGGATATAAATTTGATGATCAGAAACTGGAAGAGCAATAG

Protein sequence :
MNKKKVLIIDDDPHIREILDDYLNFEGFDAFLAEDTEKGLKILQEEKVDILILDIMLPDEDGWEFCQKIRPEYDLPIIFL
SAKDKSVDKITGLELGADDYITKPFSPREVVARIKAVLRRYNKAAENAKIIKYGELIINREQHLVSFQGEKIELTPKEFS
LLWHLAENPKKVFRRERLLKAVWGYDYYGDVRTVDTHIKSLRKKLGDKAAEAVETVWGVGYKFDDQKLEEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 4e-42 46
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-47 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 3e-42 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-42 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 4e-39 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 9e-42 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-41 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-42 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-40 45
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 6e-49 44
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 6e-37 43
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 8e-42 43
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 8e-42 43
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 4e-39 42
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family BAC0596 Protein 2e-38 42
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family BAC0039 Protein 4e-39 42
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 3e-39 42
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-38 42
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 2e-38 41
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 6e-35 41
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-37 41
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 2e-38 41
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-34 41
Halsa_0373 YP_003994202.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-34 41