Gene Information

Name : Calhy_2332 (Calhy_2332)
Accession : YP_003993402.1
Strain : Caldicellulosiruptor hydrothermalis 108
Genome accession: NC_014652
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2422938 - 2423591 bp
Length : 654 bp
Strand : +
Note : KEGG: amt:Amet_3209 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
TTGAAGATATTGCTGGTTGAGGACGAAGAAAAACTCAGAAAAGTAATAAAGTTGTATCTTGAAAAAGAAGGGTTTGAAGT
AGAAGAAGCATCGGACGGAAACGAAGCAATCGAAAAATTTCAACCTTCAATGTACTCTGTTGTAATCTTAGATGTGATGC
TACCCCAAAAAGATGGCTGGAGTGTGTTGAGAGAAATAAGGAAAAAGGATGATACGCCAGTTATAATGCTAACAGCACGC
GGCGAAGACGACGATAAGATATTTGGATTTGAACTTGGTGCTGATGATTACGTTGTAAAACCTGTCAGTCCTAAGGAAAT
TGTTGCACGTGTAAAGGCAATTTTAAAGAGGACTAAAAAGCCCAGTTCAAATGACATTTTGTTCATCGACAAAGCAGCAA
GAGAAGTATATGTAAAAGGTCAAAAAATAAATCTTACTCAAAAAGAATATGAGCTTTTATTGTACCTATATGAAAGGCAA
AACATTGCCCTTTCAAGAGAGCTGATTTTAAATAGCGTATGGGGTTATGAATATTATGGGGATCTTAGAACTGTGGATAC
ACATATTAAAAACCTCAGAGAGAAGCTCGGAGATCTCAGAGATTACATTAAAACAGTAAGAGGTTATGGATATAAGTTTG
AGGTGGAAAAATGA

Protein sequence : 
MKILLVEDEEKLRKVIKLYLEKEGFEVEEASDGNEAIEKFQPSMYSVVILDVMLPQKDGWSVLREIRKKDDTPVIMLTAR
GEDDDKIFGFELGADDYVVKPVSPKEIVARVKAILKRTKKPSSNDILFIDKAAREVYVKGQKINLTQKEYELLLYLYERQ
NIALSRELILNSVWGYEYYGDLRTVDTHIKNLREKLGDLRDYIKTVRGYGYKFEVEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 7e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-35 48
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-25 43
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-35 43
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-33 43
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 1e-34 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 4e-36 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-28 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 7e-35 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 7e-35 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-33 42
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 3e-25 41
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 6e-28 41
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 1e-28 41
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 1e-28 41
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 8e-22 41
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 6e-27 41
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calhy_2332 YP_003993402.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-22 41