Gene Information

Name : Calhy_1280 (Calhy_1280)
Accession : YP_003992368.1
Strain : Caldicellulosiruptor hydrothermalis 108
Genome accession: NC_014652
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1310291 - 1310962 bp
Length : 672 bp
Strand : +
Note : KEGG: ate:Athe_1456 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAAAATCCTTGTCATTGATGATGATGTAAAGATATGTGAGGTAATAAAACTCTACTTAGAAAAAGAAGGGTTTGAAGT
AGTAGTTGCTCACAATGGTATAGATGGAATTGCTATGTTCAAAAATGAAATGCCCGACCTTGTAATACTGGACATTATGC
TGCCCAAAAAGGATGGATATGAAGTCTGTAGAGAACTTAGAAAGATTAGTAACATTCCAATTATAATGCTCACTGCAAAG
GGAGAGACATTTGATAAGGTACTTGGATTAGAGTTGGGAGCAGATGACTACATTGTAAAACCGTTTGATCCAAAAGAACT
AATTGCACGAATAAAAGCGGTGCTGAGAAGAACACAGGGTGAAGTCAATGATGAAAAGGTTGTTGTATATCCAAATCTGA
CAGTAAATCTCACTACATATGAGGTGAAACTTGAAGATAAAGTAATAGATATGCCGCCGAAAGAGATAGAGCTTTTGTAT
TTCTTAGCATCACATCCCAACAAAGTGTTCACAAGAGAGCAGCTTCTTGACCATATATGGGGTTACAACTTTGTTGGAGA
CACTCGTACAGTTGATGTACACATCAAAAGAATAAGAGAAAAGATTGAAAAAGACAAATATCCTTGGAAGATAAAGACTG
TATGGGGTGTGGGTTATAAGTTTGAAATTTAG

Protein sequence :
MKILVIDDDVKICEVIKLYLEKEGFEVVVAHNGIDGIAMFKNEMPDLVILDIMLPKKDGYEVCRELRKISNIPIIMLTAK
GETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRRTQGEVNDEKVVVYPNLTVNLTTYEVKLEDKVIDMPPKEIELLY
FLASHPNKVFTREQLLDHIWGYNFVGDTRTVDVHIKRIREKIEKDKYPWKIKTVWGVGYKFEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-37 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-49 51
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-44 50
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-47 49
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-47 49
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 1e-41 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-47 48
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-41 46
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-38 46
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-31 43
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 5e-42 43
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 1e-33 43
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 5e-37 43
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 6e-35 42
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-37 42
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family BAC0347 Protein 3e-27 41
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-29 41
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family BAC0533 Protein 5e-33 41
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 5e-33 41
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-37 42
Calhy_1280 YP_003992368.1 two component transcriptional regulator, winged helix family VFG1702 Protein 4e-37 42