Gene Information

Name : terE (HMPREF0733_11035)
Accession : YP_003983926.1
Strain : Rothia dentocariosa ATCC 17931
Genome accession: NC_014643
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerE
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1105956 - 1106534 bp
Length : 579 bp
Strand : -
Note : COG: COG2310; Pfam: PF02342; InterPro: IPR003325

DNA sequence :
GTGGCTGCTATTAAGCTCACCAAAGGAAACCCCATCAATCTCACCAAAGAGGCACCGGGCCTGAAAAACCTCACCATCGG
CCTGGGCTGGGACCTATCCCTCGCGGGTGAAGCCTATGACCTTGACGCATCCGTCATGATCACCGACGAAAATGACAGGA
TCCTTTTTGACGATGCATCCCTCGTCTTCTTTAACAATCCCACCAGCCTTGACGGCGCGGTCGTCCACACCGGTGACAAC
CGCACTGGCGATGCTGAAGGTGACGATGAGACCATTATCGTGAACCTCGATAAAGTAGACCCAAAGGTACAGCGCCTTCA
CATCCTCGCCTCTATCTACGAAGGCGAAAAAACCGGTAAGAATTTCGGTGTAGTACGTAACGCTTATGTACGTCTGATAA
ACGACGACACTAACGAAGAAATCGCTCGTTACGACCTTTCCGAAGACTGCTCGGCAGCGCCCGCTGTACTCTTCGCGATG
GTGTACCGCCACAACGGCGAATGGCGTTTCAAAGCCGTAGAAGATCCATTCACCGGTGGTCTGCCGCATCTGCTGACCTC
CTACGGTTTCACCGTTTAA

Protein sequence :
MAAIKLTKGNPINLTKEAPGLKNLTIGLGWDLSLAGEAYDLDASVMITDENDRILFDDASLVFFNNPTSLDGAVVHTGDN
RTGDAEGDDETIIVNLDKVDPKVQRLHILASIYEGEKTGKNFGVVRNAYVRLINDDTNEEIARYDLSEDCSAAPAVLFAM
VYRHNGEWRFKAVEDPFTGGLPHLLTSYGFTV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-42 48
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-42 48
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-42 48
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-40 46
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-39 45
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-41 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-41 44
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-40 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_003983926.1 tellurium resistance protein TerE BAC0390 Protein 7e-44 48
terE YP_003983926.1 tellurium resistance protein TerE BAC0389 Protein 8e-40 44