Gene Information

Name : AXYL_01201 (AXYL_01201)
Accession : YP_003977257.1
Strain : Achromobacter xylosoxidans A8
Genome accession: NC_014640
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound-resistance protein QacE
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1269813 - 1270142 bp
Length : 330 bp
Strand : -
Note : -

DNA sequence :
ATGAAGTGGCTGTACCTGGGTGTGGCCATCATCGCCGAGATCTTCGCGACCAGCGCGCTCAAGGGATCCGAAGGCTTCAC
GCGCCTGACGCCGTCCATCATCACGGTGGTCGGCTACCTGATCTCGTTCTATTTCCTGTCGCTGACGTTGCGCGAAATTC
CCGTGGGCATCGCCTACGCGATCTGGTCCGGCGTGGGCATCGTGTTGATTTCCATCGTGGGCGCGGTGCTGTTCAAGCAA
CACCTGGACACGCCCGCGCTGATCGGCATCGGACTCATCATCGCCGGCGTGGTGGTGATGAACGTCTTCTCGAAATCCGT
CTCGCATTGA

Protein sequence :
MKWLYLGVAIIAEIFATSALKGSEGFTRLTPSIITVVGYLISFYFLSLTLREIPVGIAYAIWSGVGIVLISIVGAVLFKQ
HLDTPALIGIGLIIAGVVVMNVFSKSVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-20 58
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-20 58
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-20 58
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-20 58
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 58
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-20 58
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 58
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-20 58
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 58
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-20 58
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 58
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-20 58
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-20 58
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-20 58
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-20 58
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-20 58
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-20 58
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-20 58
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-20 58
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-20 58
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-11 46
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE NC_010410.6003348.p0 Protein 4e-22 65
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0002 Protein 4e-22 65
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE NC_002695.1.913273.p Protein 3e-15 58
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE CP001138.1.gene1489. Protein 1e-18 58
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0322 Protein 5e-21 58
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0323 Protein 6e-21 58
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0150 Protein 3e-15 57
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE CP004022.1.gene1549. Protein 1e-16 57
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0324 Protein 2e-20 56
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0377 Protein 2e-17 54
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0329 Protein 8e-19 51
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0327 Protein 2e-16 49
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0325 Protein 1e-15 47
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0326 Protein 3e-18 45
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0139 Protein 1e-15 44
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE BAC0321 Protein 9e-17 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE VFG1587 Protein 8e-12 46
AXYL_01201 YP_003977257.1 quaternary ammonium compound-resistance protein QacE VFG1586 Protein 6e-13 44