Gene Information

Name : BATR1942_20085 (BATR1942_20085)
Accession : YP_003975863.1
Strain : Bacillus atrophaeus 1942
Genome accession: NC_014639
Putative virulence/resistance : Resistance
Product : YceE protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3940107 - 3940685 bp
Length : 579 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence : 
ATGGCCATTCAATTATCAAAAGGACAGCGTGTTGATTTAACAAAGACAAATCCGGGGCTTACAAAAGCAGTGGTCGGTTT
AGGCTGGGATACGAACAAGTATTCAGGCGGAGAAGACTTTGATTTGGACGCTTCAGCCTTCCTGGTTGATGCCAATGATA
ACTGTGTGAATGATCTTGATTTTGTCTTCTACAACAATCTTGAGCATCCGAGCGGGGGCGTCATCCATACGGGTGACAAC
CGCACAGGCGAGGGAGACGGAGACGATGAGCAACTGATCGTTGATTTCTCTAAAATCCCTGCCAATATTGAGAAAATCGG
CATTACAGTAACCATTCATGATGCGGATGCACGCAGCCAAAACTTTGGACAAGTTTCCAACGCGTTTGTCCGTGTGGTGG
ATGAGAATACACAAAATGAGCTGCTTCGTTTTGATTTAGGAGAAGATTTCTCCATTGAAACAGCTGTCGTTGTTTGCGAG
CTTTACAGGCACGGAAGCGAGTGGAAATTTAACGCGATCGGCAGCGGCTTTTCCGGCGGCTTGGCTTCTCTTTGCCGGAA
CTACGGTTTACAGGTTTAA

Protein sequence : 
MAIQLSKGQRVDLTKTNPGLTKAVVGLGWDTNKYSGGEDFDLDASAFLVDANDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQLIVDFSKIPANIEKIGITVTIHDADARSQNFGQVSNAFVRVVDENTQNELLRFDLGEDFSIETAVVVCE
LYRHGSEWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-53 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-51 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-45 51
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BATR1942_20085 YP_003975863.1 YceE protein BAC0390 Protein 2e-51 56
BATR1942_20085 YP_003975863.1 YceE protein BAC0389 Protein 4e-52 56