Gene Information

Name : BATR1942_20080 (BATR1942_20080)
Accession : YP_003975862.1
Strain : Bacillus atrophaeus 1942
Genome accession: NC_014639
Putative virulence/resistance : Resistance
Product : stress adaptation protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3939485 - 3940066 bp
Length : 582 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAATTTCACTGGCAAAAGGACAAAAAGTAGATTTAACAAAAACAAATCCGGGCCTTTCAAAAGTCGTTGTCGGCTT
AGGCTGGGATACCAATAAATATGACGGCGGGCATGACTTCGATTTGGATTCAAGCGTCTTTCTTTTAGATGCGGCGGGTA
AATGCGCGTCTCAAAGCGATTTTATTTTCTATAACCAGCTTGAAGGCGGAGCGGGTTCTGTCGTTCATTCAGGAGATAAC
CTGACAGGACAGGGCGAAGGCGATGATGAGAGCGTGAAGGTGAACCTTAACGCCGTTCCTGCCAATGTTGAGAAAATTTC
ATTTGTCATCACCATTCATGAAGCAGAAGCGCGCAGCCAAAACTTCGGACAAGTTTCTAACGCCTTTGTCCGTATCGTAA
ATGAAGAGACAAATGAAGAGCTGATCCGCTACGATCTTGCGGAGGACTTCTCGATTGAAACGGCGATTATCGCAGGAGAG
CTATACAGACATAACGGCGAGTGGAAATTCTCGGCTATCGGTTCAGGCTATCAAGGCGGCCTTGCCCGCATCGCAACGGA
TTACGGTCTGCAAATCGGATAA

Protein sequence :
MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASQSDFIFYNQLEGGAGSVVHSGDN
LTGQGEGDDESVKVNLNAVPANVEKISFVITIHEAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-50 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 59
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-42 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 50
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 50
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-41 50
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BATR1942_20080 YP_003975862.1 stress adaptation protein BAC0389 Protein 3e-50 59
BATR1942_20080 YP_003975862.1 stress adaptation protein BAC0390 Protein 9e-45 55
BATR1942_20080 YP_003975862.1 stress adaptation protein BAC0392 Protein 2e-25 41