Gene Information

Name : BATR1942_12340 (BATR1942_12340)
Accession : YP_003974330.1
Strain : Bacillus atrophaeus 1942
Genome accession: NC_014639
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2409498 - 2410220 bp
Length : 723 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGCAAAAAAATTTTAGTTGTGGATGATGAAGAATCTATCGTTACTCTTTTGCAGTATAATTTGGAGCGGTCGGGCTA
CGAGGTTGTCACCGCATCAGACGGTGAAGAAGCTTTAAAACAGGCGGAGACAGAAAAACCTGACTTAATTGTGCTTGATC
TCATGCTTCCTAAATTGGATGGGATCGAAGTGTGTAAGCAGTTGAGACAGCAAAAGCTGATGTTTCCTATTTTAATGCTG
ACGGCTAAAGATGAAGAGTTTGATAAAGTGCTCGGTCTTGAACTTGGCGCTGACGATTATATGACCAAGCCATTCAGCCC
GAGAGAAGTAAATGCCAGGGTAAAGGCGATTTTAAGGCGTTCTGAAATAGCTTCTCCCTCATTTGACGGGCAGAATGACG
TCAAGGACGGCCAGTTGATCATCGGTGATCTTAAAATTCTCCCGGACCATTACGAAGCTTATTTTAAGTCAAACCAGCTT
GAGCTGACACCGAAAGAATTTGAACTGCTTCTCTACCTCGGAAAACATAAGGGCAGAGTTTTAACTAGAGATTTGCTGCT
CAGCGCTGTGTGGAATTACGATTTTGCCGGAGATACCCGGATTGTTGATGTGCATATCAGCCACCTTCGCGACAAAATCG
AAACAAATACAAAAAAACCCATCTATATTAAAACGATCAGAGGATTGGGGTATAAACTGGAGGAGCCTAAAATGAATGAA
TAA

Protein sequence :
MSKKILVVDDEESIVTLLQYNLERSGYEVVTASDGEEALKQAETEKPDLIVLDLMLPKLDGIEVCKQLRQQKLMFPILML
TAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRRSEIASPSFDGQNDVKDGQLIIGDLKILPDHYEAYFKSNQL
ELTPKEFELLLYLGKHKGRVLTRDLLLSAVWNYDFAGDTRIVDVHISHLRDKIETNTKKPIYIKTIRGLGYKLEEPKMNE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-40 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BATR1942_12340 YP_003974330.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-75 68
BATR1942_12340 YP_003974330.1 two-component response regulator HE999704.1.gene2815. Protein 1e-76 68
BATR1942_12340 YP_003974330.1 two-component response regulator NC_012469.1.7685629. Protein 4e-57 56
BATR1942_12340 YP_003974330.1 two-component response regulator NC_012469.1.7686381. Protein 1e-61 55
BATR1942_12340 YP_003974330.1 two-component response regulator AE016830.1.gene1681. Protein 7e-65 55
BATR1942_12340 YP_003974330.1 two-component response regulator AF162694.1.orf4.gene Protein 6e-38 44
BATR1942_12340 YP_003974330.1 two-component response regulator AE000516.2.gene3505. Protein 8e-41 44
BATR1942_12340 YP_003974330.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-42 44
BATR1942_12340 YP_003974330.1 two-component response regulator CP001485.1.gene721.p Protein 3e-35 44
BATR1942_12340 YP_003974330.1 two-component response regulator CP004022.1.gene3215. Protein 3e-37 44
BATR1942_12340 YP_003974330.1 two-component response regulator NC_002695.1.915041.p Protein 1e-32 43
BATR1942_12340 YP_003974330.1 two-component response regulator CP000034.1.gene3834. Protein 1e-32 43
BATR1942_12340 YP_003974330.1 two-component response regulator NC_014475.1.orf0.gen Protein 5e-43 42
BATR1942_12340 YP_003974330.1 two-component response regulator NC_005054.2598277.p0 Protein 5e-43 42
BATR1942_12340 YP_003974330.1 two-component response regulator BAC0197 Protein 3e-30 42
BATR1942_12340 YP_003974330.1 two-component response regulator BAC0533 Protein 8e-33 42
BATR1942_12340 YP_003974330.1 two-component response regulator CP000647.1.gene4257. Protein 8e-33 42
BATR1942_12340 YP_003974330.1 two-component response regulator CP004022.1.gene1676. Protein 7e-34 42
BATR1942_12340 YP_003974330.1 two-component response regulator CP001138.1.gene4273. Protein 2e-32 42
BATR1942_12340 YP_003974330.1 two-component response regulator CP001918.1.gene5135. Protein 6e-29 42
BATR1942_12340 YP_003974330.1 two-component response regulator AM180355.1.gene1830. Protein 3e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BATR1942_12340 YP_003974330.1 two-component response regulator VFG1389 Protein 4e-34 43
BATR1942_12340 YP_003974330.1 two-component response regulator VFG1702 Protein 5e-41 42
BATR1942_12340 YP_003974330.1 two-component response regulator VFG1386 Protein 9e-41 42
BATR1942_12340 YP_003974330.1 two-component response regulator VFG1563 Protein 2e-40 41