Gene Information

Name : Ilyop_2167 (Ilyop_2167)
Accession : YP_003968278.1
Strain :
Genome accession: NC_014633
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 234337 - 235005 bp
Length : 669 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR011006:IPR001789:IPR001867; KEGG: gsu:GSU0451 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional

DNA sequence :
ATGAAAATACTTGTTGTTGAAGATGAACAAAATATAATGACCTACCTTAAAAAGGGTCTGACAGAGGCCGGATATAAGGT
TGATGTTGCAGGAAACGGAGAGGACGCCATCTATCTCGCATCAATAAATAATTATGATCTCGTGATTTTAGATGTGATGA
TACCAAAGATAAATGGTCTAGAGGTGTGCAGGATTCTCAGAAGAGAAAAAAATCCAGCCTATATAATACTTTTATCTGCA
AAAGATCAGGTTCAGGATAAGGTAGAAGGTTTAGATGCAGGAGCCGATGACTATTTGACGAAACCATTTGTATTTGCAGA
ACTTTTGGCAAGAATCAGGGCGGTACTAAGAAGAAACTCTGAGGATAAAGAAAATATAATCGAAGCCAAAGGACTCACAG
TTAATCTCTTGAACAGAGAGGTGAAAAGAGGCGGGAAAGACATAGAACTTACACTAAAGGAATTTTCTTTATTAGAATAT
TTTATAAGAAACAAGAATCTTGTGCTCACAAGAACAATGATAGCTGAAAAAGTATGGAATATAGATTTTCTAACTGATAC
TAACGTAGTAGATGTTTATATAAACCACCTTAGAAAGAAGATAGACAAGGATTTTGACGACAAGTTGATCTACACTGTGA
GAGGAGTAGGATATATATTAAAAGCTTAA

Protein sequence :
MKILVVEDEQNIMTYLKKGLTEAGYKVDVAGNGEDAIYLASINNYDLVILDVMIPKINGLEVCRILRREKNPAYIILLSA
KDQVQDKVEGLDAGADDYLTKPFVFAELLARIRAVLRRNSEDKENIIEAKGLTVNLLNREVKRGGKDIELTLKEFSLLEY
FIRNKNLVLTRTMIAEKVWNIDFLTDTNVVDVYINHLRKKIDKDFDDKLIYTVRGVGYILKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-40 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-41 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-45 52
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0111 Protein 6e-50 52
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0083 Protein 5e-47 51
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-46 50
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0638 Protein 7e-41 50
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-44 49
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-38 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-42 46
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-33 45
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-33 44
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-37 43
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-31 42
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 9e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-40 48
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-45 47
Ilyop_2167 YP_003968278.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-35 42