Gene Information

Name : PPSC2_c1004 (PPSC2_c1004)
Accession : YP_003945227.1
Strain : Paenibacillus polymyxa SC2
Genome accession: NC_014622
Putative virulence/resistance : Resistance
Product : terd family tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1135797 - 1136378 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGACGATTAGTCTTTCGAAAGGACAACGGATTGATCTGACCAAAACAAATCCAGGCTTGACTCGTGTGGTCGTAGGTCT
TGGCTGGGATACCAATAAATACAGTGGCGGCGCAGAATTTGACTTGGATGCTTCGGCTTTCCTGCTATATGAGGACGGTA
AAGCGAAGGCAGCTGACGATTTTGTATTCTACAATAACCCGACAGGTGGTGCGGGTGCTGTTACTCATACAGGCGATAAC
CGCACAGGTGAGGGCGACGGGGATGACGAGCAAATTATTATTGATTTTGCAAAGATTCCTGCAAACATCCATCGTATCGG
GATTACAGTTACGATTTATGACTATGAGGCCCGTGCGCAAAACTTTGGACAAGTGTCCAATGCTTTTGTACGGGTGGTAG
ATGCGGCAACGGATCGTGAAGTGTTGCGCTACGATTTGGGAGAAGATTTCTCCACCGAAACAGCTGTGGTATTCTGTGAA
TTTTACCGTCACAATGCGGACTGGAAATTCCAGGCTATCGGTAGTGGCTTTGCTGGTGGATTGGGTGCGCTTGCTAAAAA
CTATGGCTTGGACGCTCAATAA

Protein sequence :
MTISLSKGQRIDLTKTNPGLTRVVVGLGWDTNKYSGGAEFDLDASAFLLYEDGKAKAADDFVFYNNPTGGAGAVTHTGDN
RTGEGDGDDEQIIIDFAKIPANIHRIGITVTIYDYEARAQNFGQVSNAFVRVVDAATDREVLRYDLGEDFSTETAVVFCE
FYRHNADWKFQAIGSGFAGGLGALAKNYGLDAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-42 56
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-40 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-40 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-35 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-35 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-35 55
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-39 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-35 51
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPSC2_c1004 YP_003945227.1 terd family tellurium resistance protein BAC0389 Protein 5e-40 56
PPSC2_c1004 YP_003945227.1 terd family tellurium resistance protein BAC0390 Protein 7e-38 54