Gene Information

Name : Entcl_0693 (Entcl_0693)
Accession : YP_003940252.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 724320 - 724661 bp
Length : 342 bp
Strand : +
Note : PFAM: protein of unknown function DUF1219; KEGG: ebw:BWG_0226 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system

DNA sequence :
ATGAAAACTCTACCTGCTATAATTTCGCGGGCGGCGAAGCCCTGTCTGTCGCCCGTTGCAGTCTGGCAAATGCTACTTAC
ACGCCTGCTGGAAAAACACTATGGTCTGACCCTGAACGATACGCCGTTCTGTGATGAAACCGTTATACAGGAACATATCG
ATGCCGGTATTACGCTGGCTGATGCCGTTAATTTTCTGGTGGAAAAATACGGACTGGTTCGTATCGACAGGAATGGATTT
ATCTGGCAGGAACAATCACCTTATCTTCGGGCCGTTGATATTCTGCGAGCGCGGCAGGCAACTGGCTTATTGCGACAAAG
CCGTAACAACGCAATACGTTGA

Protein sequence :
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
IWQEQSPYLRAVDILRARQATGLLRQSRNNAIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 2e-29 66
unnamed AAL57575.1 unknown Not tested LEE Protein 4e-29 65
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-28 64
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-28 64
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-28 64
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 64
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-28 63
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 3e-29 63
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 4e-29 63
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 4e-28 63
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 4e-29 63
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-28 63
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-29 62
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-29 61
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 5e-28 59
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-27 59
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 8e-28 59
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 8e-28 59
unnamed AAC31486.1 L0007 Not tested LEE Protein 5e-28 59
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 6e-28 59
unnamed AAL08478.1 unknown Not tested SRL Protein 2e-27 58
YE3459 YP_001007621.1 hypothetical protein Not tested YAPI Protein 4e-12 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_0693 YP_003940252.1 hypothetical protein VFG1682 Protein 6e-30 66
Entcl_0693 YP_003940252.1 hypothetical protein VFG1620 Protein 5e-29 64
Entcl_0693 YP_003940252.1 hypothetical protein VFG0663 Protein 1e-29 63
Entcl_0693 YP_003940252.1 hypothetical protein VFG1530 Protein 6e-28 59
Entcl_0693 YP_003940252.1 hypothetical protein VFG0786 Protein 2e-28 59
Entcl_0693 YP_003940252.1 hypothetical protein VFG1069 Protein 7e-28 58