|
Name : Entcl_0691 (Entcl_0691) Accession : YP_003940250.1 Strain : Enterobacter cloacae SCF1 Genome accession: NC_014618 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 723742 - 723963 bp Length : 222 bp Strand : + Note : PFAM: protein of unknown function DUF987; KEGG: ecm:EcSMS35_0309 hypothetical protein DNA sequence : ATGAAAATTATCAGTAAACGCCGGGCGATGACGATTTACCGCCAGTATCCGGCCTCCCGCATTTTTCGATACTGCACCGG CAGATACCAGTGGCACGGCAGTGTCTGTCATTACACCGGTCTGGCCGTTCCTGACATTCCCGGCGTGCTGGCTGTATACG CTGAACGCCGCCAGGACCGCGACGGACCTTATGCCTGTCTGATGAGTATCACTCTGAACTGA Protein sequence : MKIISKRRAMTIYRQYPASRIFRYCTGRYQWHGSVCHYTGLAVPDIPGVLAVYAERRQDRDGPYACLMSITLN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | AAK00480.1 | unknown | Not tested | SHI-1 | Protein | 5e-16 | 68 |
| yeeT | CAD42099.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-18 | 66 |
| yeeT | NP_838485.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-18 | 66 |
| yeeT | NP_708771.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-18 | 66 |
| yeeT | CAE85202.1 | YeeT protein | Not tested | PAI V 536 | Protein | 2e-18 | 66 |
| unnamed | CAD66204.1 | hypothetical protein | Not tested | PAI III 536 | Protein | 2e-18 | 66 |
| c5151 | NP_756999.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-18 | 65 |
| unnamed | AAL67344.1 | intergenic-region protein | Not tested | PAI II CFT073 | Protein | 5e-18 | 65 |
| yeeT | AAZ04459.1 | conserved hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 5e-18 | 65 |
| yeeT | AAK16199.1 | YeeT | Not tested | PAI-I AL862 | Protein | 5e-18 | 65 |
| aec74 | AAW51757.1 | Aec74 | Not tested | AGI-3 | Protein | 3e-18 | 65 |
| yeeT | CAD33788.1 | YeeT protein | Not tested | PAI I 536 | Protein | 6e-18 | 64 |
| yeeT | ADD91701.1 | YeeT | Not tested | PAI-I AL862 | Protein | 6e-18 | 64 |
| unnamed | CAI43847.1 | hypothetical protein | Not tested | LEE | Protein | 1e-17 | 64 |
| unnamed | AAL08476.1 | unknown | Not tested | SRL | Protein | 9e-18 | 64 |
| Z1218 | NP_286753.1 | hypothetical protein | Not tested | TAI | Protein | 1e-17 | 64 |
| ECO103_3590 | YP_003223447.1 | hypothetical protein | Not tested | LEE | Protein | 4e-17 | 62 |
| unnamed | AAL57578.1 | unknown | Not tested | LEE | Protein | 6e-15 | 59 |
| unnamed | CAI43902.1 | hypothetical protein | Not tested | LEE | Protein | 6e-15 | 59 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Entcl_0691 | YP_003940250.1 | hypothetical protein | VFG1679 | Protein | 9e-19 | 66 |
| Entcl_0691 | YP_003940250.1 | hypothetical protein | VFG0661 | Protein | 9e-19 | 66 |
| Entcl_0691 | YP_003940250.1 | hypothetical protein | VFG1618 | Protein | 9e-19 | 66 |
| Entcl_0691 | YP_003940250.1 | hypothetical protein | VFG1067 | Protein | 4e-18 | 64 |
| Entcl_0691 | YP_003940250.1 | hypothetical protein | VFG1529 | Protein | 2e-18 | 64 |
