Gene Information

Name : Entcl_0691 (Entcl_0691)
Accession : YP_003940250.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 723742 - 723963 bp
Length : 222 bp
Strand : +
Note : PFAM: protein of unknown function DUF987; KEGG: ecm:EcSMS35_0309 hypothetical protein

DNA sequence :
ATGAAAATTATCAGTAAACGCCGGGCGATGACGATTTACCGCCAGTATCCGGCCTCCCGCATTTTTCGATACTGCACCGG
CAGATACCAGTGGCACGGCAGTGTCTGTCATTACACCGGTCTGGCCGTTCCTGACATTCCCGGCGTGCTGGCTGTATACG
CTGAACGCCGCCAGGACCGCGACGGACCTTATGCCTGTCTGATGAGTATCACTCTGAACTGA

Protein sequence :
MKIISKRRAMTIYRQYPASRIFRYCTGRYQWHGSVCHYTGLAVPDIPGVLAVYAERRQDRDGPYACLMSITLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 5e-16 68
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 2e-18 66
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 2e-18 66
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 2e-18 66
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 3e-18 66
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 3e-18 66
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-18 65
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 5e-18 65
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-18 65
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 5e-18 65
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 3e-18 65
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 1e-17 64
unnamed AAL08476.1 unknown Not tested SRL Protein 9e-18 64
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 1e-17 64
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 6e-18 64
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 6e-18 64
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 4e-17 62
unnamed AAL57578.1 unknown Not tested LEE Protein 6e-15 59
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 6e-15 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_0691 YP_003940250.1 hypothetical protein VFG1679 Protein 9e-19 66
Entcl_0691 YP_003940250.1 hypothetical protein VFG0661 Protein 9e-19 66
Entcl_0691 YP_003940250.1 hypothetical protein VFG1618 Protein 9e-19 66
Entcl_0691 YP_003940250.1 hypothetical protein VFG1529 Protein 2e-18 64
Entcl_0691 YP_003940250.1 hypothetical protein VFG1067 Protein 4e-18 64