Gene Information

Name : Entcl_0690 (Entcl_0690)
Accession : YP_003940249.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Virulence
Product : DNA repair protein RadC
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 723251 - 723733 bp
Length : 483 bp
Strand : +
Note : KEGG: ebw:BWG_2397 CP4-57 prophage; putative DNA repair protein; TIGRFAM: DNA repair protein RadC; PFAM: DNA repair protein RadC

DNA sequence :
ATGATGGAACAGTCACTTATCCCACAGGCTCCGGCACTTCCATTGACCGCACAGCGCACGGTAAAACGCGCTTTAACGCT
GCTTGACCGACACCTGCGAGAAACAGGTGTAGCATTCACCTCCACTCAGGCTGCCCGTGACTGGCTGAAACTGAAAATGG
CGGGACTGGAGCGCGAAGAGTTTATGGTGCTGTATCTGAACCAGCAGAACCAGTTGATTGCCCATGAAATCCTGTTTGCC
GGTTCTATTAGCAGTACCGAGGTACATCCTCGTGAGGTGGTCAAACGCGCCCTGTACTTCAATGCGGCAGCAGTGATACT
GGCGCATAACCACCCTTCCGGCGACACCACGCCCAGCCAGGCAGATAAGACCATTACGCAGCGTCTGGTGCAGGCGCTCC
AGCTCATTGATATCCGTGTGCCTGACCACCTTATCGTCGGTGGCTCGCAGATATTGTCGTTCGCCGAACATGGTCTGCTC
TGA

Protein sequence :
MMEQSLIPQAPALPLTAQRTVKRALTLLDRHLRETGVAFTSTQAARDWLKLKMAGLEREEFMVLYLNQQNQLIAHEILFA
GSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADKTITQRLVQALQLIDIRVPDHLIVGGSQILSFAEHGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 1e-49 79
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 1e-49 79
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 4e-49 79
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 2e-49 79
unnamed AAL08475.1 unknown Not tested SRL Protein 2e-49 79
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 8e-50 79
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 2e-49 79
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 2e-49 79
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 2e-49 79
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-49 79
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 1e-49 79
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 4e-50 78
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 9e-48 77
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 2e-49 75
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 1e-49 75
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 2e-49 75
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 1e-49 74
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 7e-50 71
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 1e-49 71
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 4e-26 52
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 4e-26 52
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-26 52
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 3e-24 50
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 6e-25 45
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 2e-25 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_0690 YP_003940249.1 DNA repair protein RadC VFG1528 Protein 8e-50 79
Entcl_0690 YP_003940249.1 DNA repair protein RadC VFG1617 Protein 6e-50 79
Entcl_0690 YP_003940249.1 DNA repair protein RadC VFG0660 Protein 4e-50 79
Entcl_0690 YP_003940249.1 DNA repair protein RadC VFG1066 Protein 8e-50 79
Entcl_0690 YP_003940249.1 DNA repair protein RadC VFG1678 Protein 2e-50 78
Entcl_0690 YP_003940249.1 DNA repair protein RadC VFG1119 Protein 1e-26 52