Gene Information

Name : Entcl_4102 (Entcl_4102)
Accession : YP_003943619.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 4418361 - 4418690 bp
Length : 330 bp
Strand : +
Note : KEGG: kva:Kvar_4784 transcriptional regulator, AraC family; PFAM: helix-turn-helix- domain containing protein AraC type; SMART: Helix-turn-helix, AraC domain

DNA sequence : 
ATGTCCCATCACGATATTATTCAAACGCTGATTGAATGGATTGATGAACATATCGATCAACCGCTTAACATTGACGTAGT
CGCCAAAAAATCCGGCTATTCAAAATGGTATCTGCAGCGGATGTTCCGCACGGTGACGCATCAGACGCTGGGCGACTATA
TCCGCCAGCGACGCCTGCTGCTGGCGGCAGAAGCGCTAAGAACCACGCAGCGCCCGATTTTTGATATTGCGATGGATTTG
GGGTATGTCTCGCAGCAGACCTTCTCGCGCGTATTCCGCCGCGAATTCGATCGTACGCCGAGCGACTACCGCCATCAGAT
TTCGGCCTGA

Protein sequence : 
MSHHDIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHQISA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 4e-36 93
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-15 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-15 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 2e-37 97
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 6e-37 93
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 1e-36 93
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator BAC0371 Protein 1e-35 91
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 1e-35 91
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 2e-35 90
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 2e-18 48
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 2e-15 48
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 4e-16 43
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 3e-16 43
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 2e-16 42
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator BAC0560 Protein 2e-16 42
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 2e-16 42
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 2e-16 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator VFG0585 Protein 1e-36 93
Entcl_4102 YP_003943619.1 AraC family transcriptional regulator VFG1038 Protein 2e-15 48