Gene Information

Name : Entcl_3849 (Entcl_3849)
Accession : YP_003943373.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 4133813 - 4134079 bp
Length : 267 bp
Strand : +
Note : PFAM: Prophage CP4-57 regulatory; KEGG: ddc:Dd586_2885 phage transcriptional regulator, AlpA

DNA sequence : 
ATGACAATTAAACCTTCCCTGTCTGAAGACCAGTTCGTCAATATGGCTTTCATTACCCATCTCACCGGATTAACCGATAA
ATGGTTCTACAAGCTCATCAAAGACGGTGAGTTTCCGGCACCCATCAAGTTTGGTCGTAGTTCCCGCTGGCGACAGAGTG
AAGTCGAAACCTGGCTACAGGCCCGCATTGATGCATCCCGGGGAGAGAATTCCGCCCTGGCAATGACCCACAAACTTACC
GTAACTCCCGTGGAGGCGTTGTCATGA

Protein sequence : 
MTIKPSLSEDQFVNMAFITHLTGLTDKWFYKLIKDGEFPAPIKFGRSSRWRQSEVETWLQARIDASRGENSALAMTHKLT
VTPVEALS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 7e-21 78
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 2e-20 77
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 2e-20 77
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 3e-20 75
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 6e-20 72
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 4e-20 72
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 6e-20 72
unnamed AAL08466.1 unknown Not tested SRL Protein 4e-20 72
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 2e-17 60
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-17 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_3849 YP_003943373.1 phage transcriptional regulator AlpA VFG0651 Protein 2e-20 72
Entcl_3849 YP_003943373.1 phage transcriptional regulator AlpA VFG1057 Protein 2e-20 72
Entcl_3849 YP_003943373.1 phage transcriptional regulator AlpA VFG1480 Protein 8e-18 60