Gene Information

Name : Entcl_3221 (Entcl_3221)
Accession : YP_003942751.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 3438623 - 3438958 bp
Length : 336 bp
Strand : -
Note : KEGG: kva:Kvar_3818 transcriptional regulator, AraC family; PFAM: helix-turn-helix- domain containing protein AraC type; SMART: Helix-turn-helix, AraC domain

DNA sequence : 
ATGACGATTTCCGCTCAGGTGATTGACGCCATCGTCGACTGGATCGACGACAATCTGCATCAGCCGCTGCGCATTGAGGA
TATCGCCCGCCACGCGGGCTATTCAAAATGGCATCTGCAGCGTTTGTTTGTCCAACATAAAGGGGAGAACCTGGGGCGCT
ATATCCGTAAGCGCAAGCTGCTGCTGGCGGCGCAGGATCTGCGCGACACCAACCAGAAGGTCTACGATATCAGCCTGAAG
TATGGCTTTGATTCGCAGCAGACCTTCACCCGCGTCTTTACGCGAACCTTCAAACAGCCTCCCGGCGCCTGGCGCAAAGA
GCACCAGACGCACTGA

Protein sequence : 
MTISAQVIDAIVDWIDDNLHQPLRIEDIARHAGYSKWHLQRLFVQHKGENLGRYIRKRKLLLAAQDLRDTNQKVYDISLK
YGFDSQQTFTRVFTRTFKQPPGAWRKEHQTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 8e-19 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-16 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-16 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 2e-35 82
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 1e-19 49
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 2e-19 48
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 2e-19 48
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator BAC0371 Protein 2e-18 47
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 2e-18 47
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 3e-18 46
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 1e-16 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator VFG0585 Protein 2e-19 48
Entcl_3221 YP_003942751.1 AraC family transcriptional regulator VFG1038 Protein 1e-16 46