Gene Information

Name : Entcl_2297 (Entcl_2297)
Accession : YP_003941833.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 2428134 - 2428517 bp
Length : 384 bp
Strand : +
Note : KEGG: cko:CKO_01552 DNA-binding transcriptional activator MarA; PFAM: helix-turn-helix- domain containing protein AraC type; SMART: Helix-turn-helix, AraC domain

DNA sequence :

ATGTCCAGACGTAATACTGATGCCATCACTATTCATAGCATTTTGGACTGGATTGAAGATAACCTGGAGTCACCGCTGTC
GCTTGAAAAGGTGTCCGAACGTTCAGGCTATTCGAAATGGCATCTGCAGCGAATGTTCAAGAAAGAGACCGGTCATTCAC
TCGGCCAATACATTCGCAGCCGTAAGCTTACTGAAATCGCCCAGAAGTTGAAGCAGAGCAACGAGCCGATTTTATATCTG
GCCGAGCGCTATGGCTTTGAATCGCAACAAACGCTGACCCGGACGTTTAAGAACTACTTTGACGTGCCGCCGCATAAATA
TCGTATGACCAATATTCCCGGCGAGTCGCGTTATCTGTACCCCATAAATAACTGTAACTGTTAA

Protein sequence :

MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKQSNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRMTNIPGESRYLYPINNCNC

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
tetD	AAL08447.1	putative transcriptional regulator TetD	Not tested	SRL	Protein	3e-21	44
tetD	AEA34665.1	tetracycline resistance protein D	Not tested	Not named	Protein	3e-21	44
soxS	YP_219131.1	DNA-binding transcriptional regulator SoxS	Not tested	SPI-4	Protein	1e-19	43

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP000647.1.gene1624.	Protein	7e-53	96
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP001918.1.gene2033.	Protein	2e-54	94
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	BAC0560	Protein	6e-53	93
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	NC_002695.1.917339.p	Protein	6e-53	93
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP001138.1.gene1637.	Protein	9e-52	92
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP000034.1.gene1596.	Protein	8e-53	92
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	NC_010558.1.6276025.	Protein	1e-21	44
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP001138.1.gene612.p	Protein	2e-22	43
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP000034.1.gene4505.	Protein	2e-19	43
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	BAC0371	Protein	1e-19	43
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP001138.1.gene4488.	Protein	4e-20	43
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	NC_002695.1.914293.p	Protein	1e-19	43
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP001918.1.gene327.p	Protein	3e-20	43
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	CP000647.1.gene4499.	Protein	5e-20	42

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	VFG1038	Protein	1e-21	44
Entcl_2297	YP_003941833.1	AraC family transcriptional regulator	VFG0585	Protein	3e-20	43