Gene Information

Name : Entcl_2297 (Entcl_2297)
Accession : YP_003941833.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 2428134 - 2428517 bp
Length : 384 bp
Strand : +
Note : KEGG: cko:CKO_01552 DNA-binding transcriptional activator MarA; PFAM: helix-turn-helix- domain containing protein AraC type; SMART: Helix-turn-helix, AraC domain

DNA sequence :
ATGTCCAGACGTAATACTGATGCCATCACTATTCATAGCATTTTGGACTGGATTGAAGATAACCTGGAGTCACCGCTGTC
GCTTGAAAAGGTGTCCGAACGTTCAGGCTATTCGAAATGGCATCTGCAGCGAATGTTCAAGAAAGAGACCGGTCATTCAC
TCGGCCAATACATTCGCAGCCGTAAGCTTACTGAAATCGCCCAGAAGTTGAAGCAGAGCAACGAGCCGATTTTATATCTG
GCCGAGCGCTATGGCTTTGAATCGCAACAAACGCTGACCCGGACGTTTAAGAACTACTTTGACGTGCCGCCGCATAAATA
TCGTATGACCAATATTCCCGGCGAGTCGCGTTATCTGTACCCCATAAATAACTGTAACTGTTAA

Protein sequence :
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKQSNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRMTNIPGESRYLYPINNCNC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-21 44
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-21 44
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 7e-53 96
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 2e-54 94
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 6e-53 93
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator BAC0560 Protein 6e-53 93
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 9e-52 92
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 8e-53 92
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 1e-21 44
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 2e-22 43
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 2e-19 43
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator BAC0371 Protein 1e-19 43
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 4e-20 43
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 1e-19 43
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 3e-20 43
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 5e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator VFG1038 Protein 1e-21 44
Entcl_2297 YP_003941833.1 AraC family transcriptional regulator VFG0585 Protein 3e-20 43