Gene Information

Name : Entcl_2025 (Entcl_2025)
Accession : YP_003941564.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2138950 - 2139642 bp
Length : 693 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: dar:Daro_2259 two component heavy metal response transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGAGGATTTTGCTGGTTGAAGATCAAAAAATGGCCTCTGAGTACATCGCCAAGGGCCTGACGGAAAATAACTTTGTTGT
CGATGTCGCACAAAATGGCGTAGATGGGCTGCACTATCTGCTGACCAATGACTACAACCTGGCCATTCTTGACGTCATGC
TGCCGGGTATCGACGGCTGGAAAATCATTGAGATGGCCCGCCAGGCCGGGAAACAAACGCCCATTATGTTTCTGACCGCC
CGCGACGATGTTGAAGACCGCGTACGCGGCCTGGAGCTCGGCGCGGAAGATTATCTGATTAAGCCCTTTTCGTTCAGCGA
ACTGCTGGCCCGGGCGCGGGTTATCCTGCGGCGCCAGAATCCGCAGCACGCCCCGAGCGCAGATGAAAACATTCTGCAAG
TTGCTGACCTGACGCTTGATTTCATCAAACACCGGGTTACCCGCTCCGGCGTACGCATTGAGCTGACGCAAAAAGAGTTT
TTGCTGCTCAGATTACTGATGCGCCGCTCAGGTGAGGTACTGTCGCGCACCGTGCTGGCAGAACAGGTGTGGGACATGAA
CTTTGACCCTGAAACGAACGTTATCGATGTGGCTATCCGTCGCCTGCGCAGCAAAATAGACGATGGCTTCGACGATAAAT
TACTGCATACCTTACGGGGCGCGGGCTACGTGCTGGAATTACGCTCTTCATGA

Protein sequence :
MRILLVEDQKMASEYIAKGLTENNFVVDVAQNGVDGLHYLLTNDYNLAILDVMLPGIDGWKIIEMARQAGKQTPIMFLTA
RDDVEDRVRGLELGAEDYLIKPFSFSELLARARVILRRQNPQHAPSADENILQVADLTLDFIKHRVTRSGVRIELTQKEF
LLLRLLMRRSGEVLSRTVLAEQVWDMNFDPETNVIDVAIRRLRSKIDDGFDDKLLHTLRGAGYVLELRSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-57 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-57 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 3e-64 60
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-64 58
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-63 58
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 4e-65 56
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-57 56
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-61 55
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-57 52
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-36 44
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-31 43
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 5e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 7e-58 54
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 3e-40 41
Entcl_2025 YP_003941564.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 4e-35 41