Gene Information

Name : Entcl_1385 (Entcl_1385)
Accession : YP_003940932.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1461635 - 1461937 bp
Length : 303 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: epy:EpC_28130 transposase, probable fragment

DNA sequence :
ATGAAACGAAGAAATTTTAGTCCTGAATTCAAACGCGAATCCGCTCAGCTGGTTGTTGATCAAAACTACACCGTCTCTGA
TGCCGCTAAGGCTATGAATGTCGGTCTTTCCACGATGACAAAATGGGTCAAGCAACTGCGTGAAGAGCGTCAGGGAAAAA
CACCAAAAGCCTCTCCGATAACACCGGAACAAATCGAAATACGTGAACTGAAGAAAAAGCTACAACGTATTGAAATAGAA
AACGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKRRNFSPEFKRESAQLVVDQNYTVSDAAKAMNVGLSTMTKWVKQLREERQGKTPKASPITPEQIEIRELKKKLQRIEIE
NEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-39 91
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-39 91
api80 CAF28554.1 putative transposase Not tested YAPI Protein 8e-34 90
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-38 88
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-32 82
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-32 82
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-32 82
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-32 82
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-32 82
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-32 82
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-32 82
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-32 82
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 9e-29 70
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-25 63
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-25 63
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-24 61
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-24 61
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-24 61
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-24 61
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 9e-23 57
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 8e-20 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_1385 YP_003940932.1 transposase IS3/IS911 family protein VFG1485 Protein 6e-40 91
Entcl_1385 YP_003940932.1 transposase IS3/IS911 family protein VFG1123 Protein 1e-32 82
Entcl_1385 YP_003940932.1 transposase IS3/IS911 family protein VFG1553 Protein 4e-29 70
Entcl_1385 YP_003940932.1 transposase IS3/IS911 family protein VFG0784 Protein 2e-24 61
Entcl_1385 YP_003940932.1 transposase IS3/IS911 family protein VFG1566 Protein 5e-13 43