Gene Information

Name : phoB (CLOST_2557)
Accession : YP_003937577.1
Strain : Clostridium sticklandii DSM 519
Genome accession: NC_014614
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with PhoR (or CreC)
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2684898 - 2685593 bp
Length : 696 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 90133909, 91100346; Product type r : regulator

DNA sequence :
ATGAAAAATAGAGTGCTTATTGCAGAGGACGAGAAACCTATATCCGATATAATAAAATTTAATTTGGAAAAAGAAGGCTA
TGAAATAATAACAGCCTATGACGGTGAGGATGCTCTTAAGAAAGCATTAAATGAAGAGCTAGAGCTTATCATCTTAGATA
TTATGCTGCCTTCTATGGATGGATTTGAGATTTGCAAAAGAGTTAGAGAAAAATCTTCAGTGCCTATAATTATGGTTACG
GCAAAAGAAGAAGAGGTAGATAAAATTTTAGGACTAGAGCTAGGGGCTGATGATTATATCACCAAGCCATTTAGCATAAG
AGAGCTAGTTGCAAGAGTAAAAGCTAATGTTAGAAGACAAGAGATGAACATAAATGCTGACCAGCAGGAAAAAGAGATAA
TTAAAAACAAGGATTTAAGCATAGATCTTATGAAGTATGAAGTTAAAAAAGGTTCAACTAGCATTGATTTAACTGTTAGA
GAATTTGAACTGCTGAAGTTTTTGGCAAAGCAAAAAGACCAAGTTTTCTCTAGAGAGCAGCTTTTAGAAAGAGTATGGGG
TTATGAATACTATGGAGATATTCGTACAGTTGACGTTACAGTTAGAAGGCTAAGAGAAAAGGTTGAGGACGATTCTTCAA
ATCCTACCTATATCATGACTAAACGCGGCGTTGGATATTATTTTAAAGGAGAGTAA

Protein sequence :
MKNRVLIAEDEKPISDIIKFNLEKEGYEIITAYDGEDALKKALNEELELIILDIMLPSMDGFEICKRVREKSSVPIIMVT
AKEEEVDKILGLELGADDYITKPFSIRELVARVKANVRRQEMNINADQQEKEIIKNKDLSIDLMKYEVKKGSTSIDLTVR
EFELLKFLAKQKDQVFSREQLLERVWGYEYYGDIRTVDVTVRRLREKVEDDSSNPTYIMTKRGVGYYFKGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-39 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_012469.1.7685629. Protein 8e-58 57
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) HE999704.1.gene2815. Protein 7e-47 51
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002952.2859905.p0 Protein 1e-45 49
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_007622.3794472.p0 Protein 1e-45 49
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) AE016830.1.gene1681. Protein 6e-43 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002951.3237708.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_003923.1003749.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002758.1121668.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_009641.5332272.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_013450.8614421.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_007793.3914279.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002745.1124361.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_009782.5559369.p0 Protein 1e-45 48
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_012469.1.7686381. Protein 2e-42 47
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) HE999704.1.gene1528. Protein 3e-32 45
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_003923.1003417.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_013450.8614146.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002951.3238224.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_007793.3914065.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002758.1121390.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_010079.5776364.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002952.2859858.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_007622.3794948.p0 Protein 2e-35 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) AM180355.1.gene1830. Protein 1e-36 44
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_005054.2598277.p0 Protein 8e-39 43
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) DQ212986.1.gene4.p01 Protein 1e-35 43
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_014475.1.orf0.gen Protein 8e-39 43
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) AF155139.2.orf0.gene Protein 3e-36 43
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) AF130997.1.orf0.gene Protein 7e-33 42
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) FJ349556.1.orf0.gene Protein 1e-35 42
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) AE000516.2.gene3505. Protein 2e-39 42
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) AE015929.1.gene1106. Protein 9e-29 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) EU250284.1.orf4.gene Protein 5e-32 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) CP000034.1.gene2186. Protein 2e-29 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) NC_002695.1.916589.p Protein 1e-29 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) BAC0596 Protein 6e-30 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) BAC0039 Protein 2e-29 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) CP001138.1.gene2239. Protein 6e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) VFG1563 Protein 1e-39 41
phoB YP_003937577.1 DNA-binding response regulator in two-component regulatory system with PhoR (or CreC) VFG1702 Protein 2e-39 41