Gene Information

Name : CLOST_1356 (CLOST_1356)
Accession : YP_003936381.1
Strain : Clostridium sticklandii DSM 519
Genome accession: NC_014614
Putative virulence/resistance : Resistance
Product : Two-component response regulator yycF
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1516181 - 1516867 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGGCAAATATCCTTGTCGTTGACGATGAGCCTTTGATAGTAAAAGGGCTGAAGTTTTCACTTGAACAAGGAGGTCATAT
AATTGATACATCATTTGATGGAAATGATGCGCTTGAAAATATTAAATCAAAGGATTATGACATTATACTTTTGGATTTGA
TGCTGCCAATTATAGATGGATTTGAAGTATGCAAAAAAGTCAGAGAAACCTCTGATGTTCCAATCATAATTTTAAGCGCT
AAAGGAGAAGACATTAGCAAAATCAAAGGTCTAGAAATAGGTGCAGACGACTATATAACAAAACCATTTAACATAATGGA
GTTAAAGGCTAGAGTTAATGCAATACTGAGGAGAATGGAAAAATCGAAAAAAATAGTTGCTCAAAAACATTTAGGGGATA
TTACTTTAAACTATTTAGACAGAAAAGTAACTAGAAACTCTGAGGAAATAAATTTGACCTCGAAGGAATTTGATTTGTTG
TTTTTATTAATGGATAATCCTAATAAGGTTTTTTCGAGAGAGGCATTGCTCGAGAAGGTATGGAAGTATGAACATTTTGG
GGATTTGAGAACAGTTGATGTGCATATTAGAAAATTAAGAGAAAAAATAGAAGATAACTCCTCGAATCCCGTTCATATTA
TGACAAAATGGGGTGAAGGATATTATTTCCAATTTAAAAAAGAATAG

Protein sequence :
MANILVVDDEPLIVKGLKFSLEQGGHIIDTSFDGNDALENIKSKDYDIILLDLMLPIIDGFEVCKKVRETSDVPIIILSA
KGEDISKIKGLEIGADDYITKPFNIMELKARVNAILRRMEKSKKIVAQKHLGDITLNYLDRKVTRNSEEINLTSKEFDLL
FLLMDNPNKVFSREALLEKVWKYEHFGDLRTVDVHIRKLREKIEDNSSNPVHIMTKWGEGYYFQFKKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 3e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_012469.1.7685629. Protein 1e-42 48
CLOST_1356 YP_003936381.1 Two-component response regulator yycF AE016830.1.gene1681. Protein 2e-34 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002952.2859905.p0 Protein 4e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002745.1124361.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_009782.5559369.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002951.3237708.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_007622.3794472.p0 Protein 4e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002758.1121668.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF HE999704.1.gene2815. Protein 2e-33 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_009641.5332272.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_013450.8614421.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_007793.3914279.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_003923.1003749.p0 Protein 3e-38 46
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002758.1121390.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_010079.5776364.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002952.2859858.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_007622.3794948.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_003923.1003417.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_013450.8614146.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_002951.3238224.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_007793.3914065.p0 Protein 2e-33 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF AM180355.1.gene1830. Protein 2e-29 45
CLOST_1356 YP_003936381.1 Two-component response regulator yycF NC_012469.1.7686381. Protein 3e-31 44
CLOST_1356 YP_003936381.1 Two-component response regulator yycF FJ349556.1.orf0.gene Protein 5e-34 44
CLOST_1356 YP_003936381.1 Two-component response regulator yycF AF155139.2.orf0.gene Protein 5e-34 43
CLOST_1356 YP_003936381.1 Two-component response regulator yycF AE000516.2.gene3505. Protein 1e-31 43
CLOST_1356 YP_003936381.1 Two-component response regulator yycF CP001581.1.gene280.p Protein 9e-22 42
CLOST_1356 YP_003936381.1 Two-component response regulator yycF DQ212986.1.gene4.p01 Protein 2e-28 42
CLOST_1356 YP_003936381.1 Two-component response regulator yycF AE015929.1.gene1106. Protein 5e-26 41
CLOST_1356 YP_003936381.1 Two-component response regulator yycF HE999704.1.gene1528. Protein 9e-27 41
CLOST_1356 YP_003936381.1 Two-component response regulator yycF AF130997.1.orf0.gene Protein 1e-24 41