Gene Information

Name : rama3 (Pvag_3571)
Accession : YP_003933139.1
Strain : Pantoea vagans C9-1
Genome accession: NC_014562
Putative virulence/resistance : Resistance
Product : transcriptional activator ramA
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 3795999 - 3796367 bp
Length : 369 bp
Strand : +
Note : AraC-type DNA-binding domain-containing proteins

DNA sequence : 
ATGAATCAGCGCGAGTTTATTCGGAGTTTGCTGGACTGGATTGAGAACAACTTAGGACACGATCTGCATCTGGATGAGGT
GGCACGCCGCTCGGGCTATTCGCGCTGGCATCTGCAACGCTTGTTTCGCCAGCACACCGGCTTTTCACTGGCAGAATATA
TCCGCCAGCGCCGCTTAACCGAGTCTGCACTCAGTCTGCTAAGCAGCAACGAAGCGATACTGCAGGTGGCGATGAACTAC
GGCTTCGATACCCAGCAGGCCTACACCCGCACCTTTAAAAACTACTTTATGATGACGCCAGGCCAGCTGCGCCGTCAGCG
TCGCGTCGAACCAGATCGGCTGCTGTTTCCTCTGGCGATGGCCAGCTGA

Protein sequence : 
MNQREFIRSLLDWIENNLGHDLHLDEVARRSGYSRWHLQRLFRQHTGFSLAEYIRQRRLTESALSLLSSNEAILQVAMNY
GFDTQQAYTRTFKNYFMMTPGQLRRQRRVEPDRLLFPLAMAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-20 49
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-20 49
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rama3 YP_003933139.1 transcriptional activator ramA CP001918.1.gene2033. Protein 3e-23 55
rama3 YP_003933139.1 transcriptional activator ramA CP000647.1.gene1624. Protein 4e-22 54
rama3 YP_003933139.1 transcriptional activator ramA NC_002695.1.917339.p Protein 6e-23 54
rama3 YP_003933139.1 transcriptional activator ramA BAC0560 Protein 6e-23 54
rama3 YP_003933139.1 transcriptional activator ramA CP000034.1.gene1596. Protein 5e-23 54
rama3 YP_003933139.1 transcriptional activator ramA CP001138.1.gene1637. Protein 1e-22 53
rama3 YP_003933139.1 transcriptional activator ramA NC_010558.1.6276025. Protein 3e-20 49
rama3 YP_003933139.1 transcriptional activator ramA CP001918.1.gene327.p Protein 8e-19 42
rama3 YP_003933139.1 transcriptional activator ramA CP001138.1.gene4488. Protein 6e-19 41
rama3 YP_003933139.1 transcriptional activator ramA CP000647.1.gene4499. Protein 5e-19 41
rama3 YP_003933139.1 transcriptional activator ramA CP001138.1.gene612.p Protein 1e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rama3 YP_003933139.1 transcriptional activator ramA VFG1038 Protein 3e-20 49
rama3 YP_003933139.1 transcriptional activator ramA VFG0585 Protein 6e-19 41