Gene Information

Name : marA (Pvag_1266)
Accession : YP_003930905.1
Strain : Pantoea vagans C9-1
Genome accession: NC_014562
Putative virulence/resistance : Resistance
Product : HTH-type transcriptional activator rhaR
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 1337053 - 1337394 bp
Length : 342 bp
Strand : +
Note : Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain

DNA sequence : 
ATGATGAGTGACGCCTTTATTCATGATTTAATCGACTGGATTGATAACAACATTGAAGCACGTCTGGACCTGGATACGGT
TTCAGAACGCGCCGGTTACTCTAAATGGCACCTGCAGCGTATGTTCAAAGAACATACCGGCTACCCACTGGGTGAATACA
TCCGGGTTAAGAAACTGAAGAAATCAGCCGATCGTCTGACCAGCACCGATGAACCGATTCTCAATGTGGCGATCTCATTA
GGCTTCGACTCTCAGCAATCTTTTAACCGCAGCTTCAAACGTCAGTATGGTGTCGCGCCGGGTGCATGGCGTCGTCACAG
CGGGGAATCGCACGCCGCATAA

Protein sequence : 
MMSDAFIHDLIDWIDNNIEARLDLDTVSERAGYSKWHLQRMFKEHTGYPLGEYIRVKKLKKSADRLTSTDEPILNVAISL
GFDSQQSFNRSFKRQYGVAPGAWRRHSGESHAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-19 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-19 46
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-22 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP001918.1.gene2033. Protein 3e-25 54
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP000647.1.gene1624. Protein 5e-25 53
marA YP_003930905.1 HTH-type transcriptional activator rhaR NC_002695.1.917339.p Protein 3e-25 53
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP001138.1.gene1637. Protein 4e-25 53
marA YP_003930905.1 HTH-type transcriptional activator rhaR BAC0560 Protein 3e-25 53
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP000034.1.gene1596. Protein 2e-25 53
marA YP_003930905.1 HTH-type transcriptional activator rhaR NC_010558.1.6276025. Protein 7e-20 46
marA YP_003930905.1 HTH-type transcriptional activator rhaR BAC0371 Protein 4e-23 45
marA YP_003930905.1 HTH-type transcriptional activator rhaR NC_002695.1.914293.p Protein 4e-23 45
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP001138.1.gene4488. Protein 5e-23 44
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP000034.1.gene4505. Protein 8e-23 44
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP001918.1.gene327.p Protein 4e-23 44
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP001138.1.gene612.p Protein 1e-21 43
marA YP_003930905.1 HTH-type transcriptional activator rhaR CP000647.1.gene4499. Protein 3e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_003930905.1 HTH-type transcriptional activator rhaR VFG1038 Protein 6e-20 46
marA YP_003930905.1 HTH-type transcriptional activator rhaR VFG0585 Protein 5e-23 44