Gene Information

Name : yceD (BAMF_0263)
Accession : YP_003918859.1
Strain : Bacillus amyloliquefaciens DSM 7
Genome accession: NC_014551
Putative virulence/resistance : Resistance
Product : general stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 285431 - 286012 bp
Length : 582 bp
Strand : +
Note : General stress protein 16U; GSP16U;, Bacterial stress protein, Bacterial stress protein

DNA sequence : 
ATGGCAATTTCATTGGCAAAAGGGCAAAAAGTAGATTTGACTAAAACAAATCCGGGTCTTTCTAAAGTCGTTGTCGGCCT
TGGCTGGGATACAAACAAATACGACGGCGGACATGATTTTGATTTAGATTCCAGCGTCTTTCTATTAAATGAAGCGGGAA
GATGCGCGTCGCCTGATGATTTCATTTTCTATAATCAGCTTGAAGGCGGAAACGGTTCCGTCGCACATTCAGGCGACAAC
CTGACAGGCCAGGGCGAGGGTGACGATGAAAGCGTAAGAGTCAACCTGAGTGCGGTGCCTGCCGCTATTGACAAAATCTC
ATTTGTCATCACGATTCATGAAGCGGAAGCGCGCGGCCAAAACTTCGGACAAGTCTCCAACGCGTTCGTGCGCATTGTTA
ATGAAGAAACAAATGAAGAGCTGATCCGCTATGATCTGGCTGAAGATTTCTCAATCGAAACAGCCATTATCGCAGGGGAG
CTCTACAGACATAACGGCGAATGGAAATTTTCCGCGATCGGCTCAGGCTACCAAGGCGGACTGGCCCGTATTGCGACAGA
TTACGGCCTTCAAATCGGCTGA

Protein sequence : 
MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLNEAGRCASPDDFIFYNQLEGGNGSVAHSGDN
LTGQGEGDDESVRVNLSAVPAAIDKISFVITIHEAEARGQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-55 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-55 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-55 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-47 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 50
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 50
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-46 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_003918859.1 general stress protein BAC0389 Protein 1e-55 58
yceD YP_003918859.1 general stress protein BAC0390 Protein 6e-51 54