Gene Information

Name : BC1003_0046 (BC1003_0046)
Accession : YP_003905345.1
Strain :
Genome accession: NC_014539
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 53220 - 53651 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: bpy:Bphyt_0028 transcriptional regulator, MerR family; SMART: regulatory protein MerR

DNA sequence :
ATGAAAATCGGCGAGTTGGCGAAAATCGCCCATTGCACGACCGAAACCATCCGCTTCTACGAGAAAGAAGGGCTGCTGCC
CGAAGCGGAGCGCACCGAGGCCAATTACCGCAGCTATACCGCAAGGCACGTGGAGCGGTTGCGCTTCATTCGCAATTGCC
GCGCGCTTGACATGACGCACGACGAAATTCGCGCGCTGCTGCGTCTGACCGACGCACCGGCGAGCGGCTGCGGCGGCGTC
AATGACCTGATCGACGAGCACATTGCACACGTCGAAATGCGCATCGACGAACTGCAGCAGCTCAAGGCGCAATTGCATGC
GCTGCGCGAGCAATGTCACGGCGAACGGGCCGTGGAAGACTGCGGCATCGTGCAGGGTCTCAGCGACATGAACGTGAGCG
CGCCGCGTGCGCGGCACACGCATCTTGGTTGA

Protein sequence :
MKIGELAKIAHCTTETIRFYEKEGLLPEAERTEANYRSYTARHVERLRFIRNCRALDMTHDEIRALLRLTDAPASGCGGV
NDLIDEHIAHVEMRIDELQQLKAQLHALREQCHGERAVEDCGIVQGLSDMNVSAPRARHTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 1e-32 53
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 3e-32 51
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-32 51
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-32 51
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-32 51
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 4e-32 50
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 6e-32 50
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 4e-32 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1003_0046 YP_003905345.1 MerR family transcriptional regulator BAC0301 Protein 3e-33 62
BC1003_0046 YP_003905345.1 MerR family transcriptional regulator BAC0058 Protein 5e-39 59