Gene Information

Name : BC1003_2852 (BC1003_2852)
Accession : YP_003908096.1
Strain :
Genome accession: NC_014539
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3334613 - 3335275 bp
Length : 663 bp
Strand : -
Note : KEGG: bpy:Bphyt_3267 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGCGCATCTTGCTAGTCGAAGACGACCGGATGATCGCGGAAGGCGTGCGCAAGGCGCTGCGCGGTGAAGGCTTCGCGGT
CGACTGGGTGGAAGACGGCGAAGCGGCGCTCAGCGCGGCGACGAGCCAACCGTACGATCTGGTGCTGCTCGACCTTGGAC
TACCCAAACGCGACGGCCTGGACGTGTTGCGCGCGCTGCGCGCCCGCGGCCACGCGCTGCCGGTGCTGATCGTCACGGCG
CGCGACGCAGTGGCCGACCGCGTGAAGGGCCTCGACGCCGGTGCGGACGATTACCTCGTCAAGCCGTTCGACCTCGACGA
ACTCGGCGCGCGCATGCGGGCTCTGATCCGCCGCCAGTCCGGCCGCAGCGATTCGACGATCCGCCACGGCAATCTGACGC
TCGACCCAGCGTCGCATCAGGTGACGCTCGAGGGCGCGCCGGTGGCTCTGTCTGCGCGCGAGTTCGCGCTGCTGGAGGCG
CTCCTCGCGCGGCCGGGCGCGGTGCTCTCGAAGAGCCAGCTCGAAGAAAAAATGTACGGCTGGGGCGAGGAGATCGGCAG
CAACACCGTCGAAGTCTACATACACGCGCTACGCAAGAAGCTCGGCGCGGATCTCATCCGCAATGTGCGTGGGCTCGGCT
ACATGATCGCGAAGGAAGCCTGA

Protein sequence :
MRILLVEDDRMIAEGVRKALRGEGFAVDWVEDGEAALSAATSQPYDLVLLDLGLPKRDGLDVLRALRARGHALPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQSGRSDSTIRHGNLTLDPASHQVTLEGAPVALSAREFALLEA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGADLIRNVRGLGYMIAKEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-41 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-29 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator BAC0487 Protein 8e-39 49
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-35 45
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-31 44
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 6e-30 44
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-29 43
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-39 48
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-35 46
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-29 43
BC1003_2852 YP_003908096.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-27 43