Gene Information

Name : BC1003_2093 (BC1003_2093)
Accession : YP_003907345.1
Strain :
Genome accession: NC_014539
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2427232 - 2427909 bp
Length : 678 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: bcm:Bcenmc03_6987 two component heavy metal response transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGCATATCCTGATCGTCGAAGACGAGCCCAAAACCAGTGCATACCTCAAGAAAGGCCTTGAAGAATCGGGCTTCTCCGT
CGACCTTGCCAGCGACGGCGCCGAGGGCCTTCTGCTCGCTCAGGAGCAGGACTACGACGTGATCGTGCTCGACGTCATGC
TGCCGACCATGGACGGCTGGGCCGTGCTCAAGGTGCTGCGCGCGACGCATGCCACTCCGGTGCTGTTCCTCACCGCTCGA
GACGACGTGAACGACCGCGTGCGCGGCCTTGAACTGGGCGGCGACGATTACCTCGTCAAACCATTCGCGTTTGTCGAATT
TCTGGCTCGCGTGCGCACGCTGGCGCGGCGCGGTCCGCCGCGAGAAAGCGAACGGCTCGCGGTCGGCGATCTGGAGATGG
ACATACAGCGGCGGCGCGTGAAACGCGGCGCAACGCGTATCGATCTGACGCCCCGCGAATTCTCGCTGCTGCAACTGCTC
GTGCGCCGTCAGGGCGAGGTGCTGAGCCGCACGCAGATCGCCTCATACGTGTGGGACATGAATTTCGACAGCGATACGAA
CGTCGTCGAGGTGGCGATTCGCCGCTTGCGCGCGAAGATCGACGACGCTTTTCCCGTCAAGCTGATCCAGACCGTGCGCG
GCGTTGGCTACGTAATCGAAGCGAAAGACCCGGACTAA

Protein sequence :
MHILIVEDEPKTSAYLKKGLEESGFSVDLASDGAEGLLLAQEQDYDVIVLDVMLPTMDGWAVLKVLRATHATPVLFLTAR
DDVNDRVRGLELGGDDYLVKPFAFVEFLARVRTLARRGPPRESERLAVGDLEMDIQRRRVKRGATRIDLTPREFSLLQLL
VRRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIQTVRGVGYVIEAKDPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-59 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-58 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-72 67
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-69 63
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-67 61
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-57 60
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-63 58
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-62 56
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-58 54
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-38 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-33 42
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-59 54
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-38 49
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-40 45
BC1003_2093 YP_003907345.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-36 43