Gene Information

Name : Thet_0940 (Thet_0940)
Accession : YP_003903856.1
Strain : Thermoanaerobacter sp. X513
Genome accession: NC_014538
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 946297 - 947001 bp
Length : 705 bp
Strand : +
Note : KEGG: tpd:Teth39_0825 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGCCCATACGGTTTTGGTTATAGAAGATGAAATTCATATATTGGAACTTTTAAGATACAACTTGGAAGCAGCAGGATA
CAAAGTTATTACTTCGGAAAATGGAAAAGAAGGCTTGGATAAAGCACTTGAAGGAAAACCTGATTTGGTTATATTAGATT
TGATGTTGCCAGATGTGGATGGACTGGAAATATGTAAAATTTTAAAAAAGAATGATGAAACGAAAAATATACCGATAATA
ATGTTAACAGCAAAAAGCGAAGAATTTGATAAAGTATTGGGATTGGAGTTGGGAGCAGATGATTATATAACAAAGCCTTT
CAGCGTAAGAGAATTGTTAGCTCGAATTAAAGCCGTTCTTCGGCGAACCCAACAACCAGATGAAGAAAAAGAAGGAATAA
TAAAATTTGGTGATATAGTTATAGATACTGGAAAGCATTTGGTTTATAAAAAAGGAAAAGTCCTAGAATTGACTTTAAAA
GAGTTTGAGCTTTTAAAACTTTTGTCTCAAAATATGGGTAAAGTATTAACTAGAGACTATCTTTTAGACAAAGTATGGGG
ATATGAATATGCTGGAGAAACTCGAACTGTTGATGTACACATCAGGCATTTAAGAAAGAAAATAGAAGACGATGATAAAT
CCCCTGTATATATTGAAACTGTAAGAGGAATTGGGTATAAGTTAAATGATAAAGGTGAAGCGTAA

Protein sequence :
MAHTVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKALEGKPDLVILDLMLPDVDGLEICKILKKNDETKNIPII
MLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRRTQQPDEEKEGIIKFGDIVIDTGKHLVYKKGKVLELTLK
EFELLKLLSQNMGKVLTRDYLLDKVWGYEYAGETRTVDVHIRHLRKKIEDDDKSPVYIETVRGIGYKLNDKGEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 9e-35 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 41
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 1e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-51 55
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-50 54
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-47 51
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-47 50
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-46 49
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-32 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-36 48
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-33 44
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-30 44
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-36 43
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-35 42
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-28 42
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-35 42
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-35 42
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-37 42
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-28 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-30 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-31 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-29 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 8e-31 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 6e-31 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 9e-29 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator BAC0039 Protein 8e-31 41
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator BAC0596 Protein 9e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-34 43
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-33 42
Thet_0940 YP_003903856.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-27 41