
|
Name : Mpet_2820 (Mpet_2820) Accession : YP_003896000.1 Strain : Methanoplanus petrolearius DSM 11571 Genome accession: NC_014507 Putative virulence/resistance : Virulence Product : XRE family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG1476 EC number : - Position : 2838405 - 2838599 bp Length : 195 bp Strand : - Note : COGs: COG1476 transcriptional regulator protein; InterPro IPR001387; KEGG: rci:RCIX1527 putative transcription regulator; PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; SPTR: Putative transcription regulator; PFAM: Helix-tu DNA sequence : ATGGAGACAAGAATCCGGGAGTTCCGGGCGAAGAAAGATATGACCCAGGCGCAGCTTGCAGAGGCTGTCGGCGTAAGGAG AGAGACGATTGTCTTTCTTGAGAAGGGCAAGTACAATCCCTCACTTAAACTTGCCCATGACGTTGCAAAGGCACTTGATA CGACAATCGAGGAGCTTTTCGTTTTTGATGATTAG Protein sequence : METRIREFRAKKDMTQAQLAEAVGVRRETIVFLEKGKYNPSLKLAHDVAKALDTTIEELFVFDD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SH2314 | YP_254229.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 5e-09 | 47 |
| EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 2e-06 | 43 |
| ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 2e-06 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Mpet_2820 | YP_003896000.1 | XRE family transcriptional regulator | VFG2175 | Protein | 6e-07 | 43 |
| Mpet_2820 | YP_003896000.1 | XRE family transcriptional regulator | VFG2168 | Protein | 6e-07 | 43 |