Gene Information

Name : Cyan7822_1946 (Cyan7822_1946)
Accession : YP_003887204.1
Strain : Cyanothece sp. PCC 7822
Genome accession: NC_014501
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2152007 - 2152759 bp
Length : 753 bp
Strand : -
Note : KEGG: mar:MAE_52640 OmpR family two-component response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGTTATCTCTAGATGTGCCTCAACTGTCTTCCAACGCTGATTTAGTTCAAACCCATCGTATTCTGGTCGTAGAAGACGA
GGATGTAATTCGAGATATGGTAGTTCTCGCCTTAGAAGAAGAGGGTTATGAGGTTAAAAGTGCTTCTGATGGGCGCTCAG
CCCTAGAATTATTACAAGGGTCAGATGCAGTTGAATCAGAAAAACTGTTTGATTTATTAGTGTTAGATTTAATGCTACCC
TCTGTCAATGGCTTGGATATTTGTCGTCTGATCCGTTATCAAGGCAACACCATCCCCATTTTAATTCTCAGTGCTAAAGT
TAGTGAAACTGATCGGGTTCTGGGGTTAGAAGTCGGGGCCGATGATTATCTGACTAAACCTTTTAGTATGCGCGAATTAG
TCGCCAGATGCCGCGCATTACTTCGTCGCCAGAGTTTTAGTACCATTTCTGCTAATCCCGTGCGAAAGTTTCGGGATATT
ATGCTTTATACTCAAGAATGCCGCGTATTAGTCAGAGGAGAAGAAATCAACTTATCTCCTAAAGAGTTTCGTTTACTAGA
GTTATTTATGAGTTATCCCCGTCGAGTTTGGTCTAGAGAACAATTGATAGAACAAGTTTGGGGACCCGATTTTTTAGGCG
ATACCAAAACCGTAGATGTTCATATTCGCTGGTTACGGGAAAAATTAGAACGGGACCCTAGTCAACCAGAATATTTAATT
ACGGTTCGGGGTTTTGGTTATCGGTTTGGGTAA

Protein sequence :
MLSLDVPQLSSNADLVQTHRILVVEDEDVIRDMVVLALEEEGYEVKSASDGRSALELLQGSDAVESEKLFDLLVLDLMLP
SVNGLDICRLIRYQGNTIPILILSAKVSETDRVLGLEVGADDYLTKPFSMRELVARCRALLRRQSFSTISANPVRKFRDI
MLYTQECRVLVRGEEINLSPKEFRLLELFMSYPRRVWSREQLIEQVWGPDFLGDTKTVDVHIRWLREKLERDPSQPEYLI
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-36 46
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 44
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-36 43
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-24 42
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-37 42
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-27 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-24 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-32 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator VFG1390 Protein 7e-34 42
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-26 42
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-31 41
Cyan7822_1946 YP_003887204.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-31 41