Gene Information

Name : zntR (Dda3937_02649)
Accession : YP_003881298.1
Strain : Dickeya dadantii 3937
Genome accession: NC_014500
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 564416 - 564847 bp
Length : 432 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATCGGCGATCTGGCGAAAGCGACCAACACCACACCGGAAACCATTCGTTTTTATGAGAAGAAAGGGCTATTGCC
CGAACCGGAACGCACCGAAGGGAACTACCGTCACTATTATCAGTTTCATGTTGATCGGCTGCGGTTTATCCGTAACTGCC
GTTCGCTGGACATGAACCATGATGAAATCCGCGCTCTGGTTGCGCTGAGCGAGCAACCGGCCGCCAGCTGCGAGGGGGTG
AACGTGTTGCTGAATGAACATCTGGGGCACGTGGAAGCGCGCATCGCCGAGCTGCAGCAACTGAAAGCGCAACTGATGCA
CATCAGCCAGCGCTGTCAGGTCACGCAGACGGTGGACGGTTGCGGCATCCTGCACGGTTTGTCTGCGCTGGAACCGGAAG
AAAGCGGCACCGGTCATACGCATTTGGGGTGA

Protein sequence :
MKIGDLAKATNTTPETIRFYEKKGLLPEPERTEGNYRHYYQFHVDRLRFIRNCRSLDMNHDEIRALVALSEQPAASCEGV
NVLLNEHLGHVEARIAELQQLKAQLMHISQRCQVTQTVDGCGILHGLSALEPEESGTGHTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-29 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-29 46
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-29 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-29 46
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-29 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 7e-30 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 7e-30 46
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 5e-30 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
zntR YP_003881298.1 MerR family transcriptional regulator BAC0301 Protein 9e-31 52
zntR YP_003881298.1 MerR family transcriptional regulator BAC0058 Protein 3e-34 51