Gene Information

Name : PPE_00939 (PPE_00939)
Accession : YP_003869326.1
Strain : Paenibacillus polymyxa E681
Genome accession: NC_014483
Putative virulence/resistance : Resistance
Product : Stress response protein SCP2
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1024379 - 1024972 bp
Length : 594 bp
Strand : +
Note : COGMatches:COG2310; PfamMatches:PF02342; go_process: response to stress (GO:0006950)

DNA sequence : 
GTGGCTGTAATTAATCTGGTCAAGGGCCAGAAAATTGATTTGACCAAGGGAAACACAGGACTAACCAAGGTTATAGCAGG
ATTGGGATGGGACCCAGTACAGTCCAAAGGATTTTTTGGCTTTAAGAAGCAACCCAATATTGATTGTGACGCTTCTGCCA
TTTTGTTGGACGCCAACGGAAAACTGACTCAGTCAGATAACGTAGTGTGTTTCCACAATAAAAAAAGTCCATGCGGCTCT
GTCGTGCATTCCGGTGATAATCTGACCGGACAAGGCGACGGTGATGATGAACAAATTGCGATTGACCTGGCACGTATTCC
TGCCAATGTCGACAAAGTGCTTGTTGTTGTGAATATATATGATTGCGTAAACCGGAAACAGGACTTCGGCATGATCGAGA
AAGCGTATATCCGCATTCTGGACGGTGCTAATTCCAAGGAACTGGTGACGTTTAATTTATCTGATAATTATGAAGGGCTG
ACCGCACTGGTCTGTGGAGAACTCTATCGTCATAACAACGAATGGAAGTTTGCTGCAATCGGTGAAGGAACCCATGCCGT
ACATATTGATGTGCTGGCTCAGCGTTATATGTAA

Protein sequence : 
MAVINLVKGQKIDLTKGNTGLTKVIAGLGWDPVQSKGFFGFKKQPNIDCDASAILLDANGKLTQSDNVVCFHNKKSPCGS
VVHSGDNLTGQGDGDDEQIAIDLARIPANVDKVLVVVNIYDCVNRKQDFGMIEKAYIRILDGANSKELVTFNLSDNYEGL
TALVCGELYRHNNEWKFAAIGEGTHAVHIDVLAQRYM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-26 45
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-33 45
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-37 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-35 42
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-35 42
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-35 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-32 42
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-33 42
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-33 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPE_00939 YP_003869326.1 Stress response protein SCP2 BAC0389 Protein 5e-33 43
PPE_00939 YP_003869326.1 Stress response protein SCP2 BAC0390 Protein 4e-35 42