Gene Information

Name : yceE (BSUW23_01490)
Accession : YP_003864664.1
Strain : Bacillus subtilis W23
Genome accession: NC_014479
Putative virulence/resistance : Resistance
Product : stress adaptation protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 299330 - 299908 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGCCATTCAATTATCAAAAGGACAGCGCATTGATTTAACGAAAACAAATCCGGGACTCGCAAAAGCGGTGATCGGCTT
AGGCTGGGATACAAACAAGTACTCTGGCGGACACGATTTTGACCTGGATGCTTCAGCCTTTTTAGTTGATGCTCATGATA
ACTGCGTGAATGATCTCGATTTCGTCTTCTATAATAACCTTGAACATCCGAGCGGCGGTGTCATCCATACGGGTGACAAC
CGCACGGGTGAGGGTGACGGAGATGATGAGCAGATTATCGTTGATTTCTCAAAGATCCCTGCACACATTGAGAAAATCGG
CATCACAGTGACCATTCACGACGCTGAAGCACGCAGCCAAAACTTTGGACAAGTTTCCAATGCGTTTGTGCGTGTGGTGG
ACGAAGAGACGCAGGATGAGCTTCTGCGCTTCGATTTGGGAGAAGATTTCTCCATTGAAACAGCTGTTGTCGTTTGTGAG
CTTTACAGACACGGCGGCGAGTGGAAATTCAATGCGATTGGCAGCGGATTTTCCGGCGGGCTGGCTGCATTGTGCCGGAA
CTACGGTTTGCAAGTGTAA

Protein sequence :
MAIQLSKGQRIDLTKTNPGLAKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQDELLRFDLGEDFSIETAVVVCE
LYRHGGEWKFNAIGSGFSGGLAALCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-53 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-51 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-51 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-51 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-44 49
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_003864664.1 stress adaptation protein BAC0390 Protein 3e-51 55
yceE YP_003864664.1 stress adaptation protein BAC0389 Protein 1e-51 54