Gene Information

Name : FB2170_11161 (FB2170_11161)
Accession : YP_003863104.1
Strain : Maribacter sp. HTCC2170
Genome accession: NC_014472
Putative virulence/resistance : Virulence
Product : response regulator DrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2788815 - 2789513 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAACATTCTTATCATAGAAGATGATCCGGAGATTATAAAGCTTCTAGAAATTCATCTCACCGATTTAATCTATAC
AACAGCCAAGGCAATGGATGGACAACAGGGTTTGAATATGGCCTTGGAAAATAATTATGATCTTATTCTCTTGGATTTAA
CCCTACCAACACTGGATGGGGTAGAAATATGTAAAAAACTTAGGGCTGTAAAGAATACACCAATTATTATGCTTACAGCT
AAATCTGAGGAGATAGACAGGGTACTTGGTCTTGAGATAGGTGCAGATGACTATATCACCAAACCTTTTAGTATCAGAGA
GTTATTGGCAAGAGTGAAAGCAGTATTAAGAAGAACTGATATTAAAGAAACTAAAAAAGAAAACACTGCCTCAATACATG
CTGAAGGCTTGTTTATTGATATAGATAAAAGAAAAGTTCTATTGGAGGATGACAAGATTGAACTTAGCCCGAAAGAATTT
GAACTCTTGGTATTAATGGCTTCAAATCCTGGAAGGAATTACACAAGGACGGAGTTACTGAACATTATCTGGGGATACAA
TTTTGAAGGATATGAGCATACGGTCAATTCGCATATAAATCGGCTGCGCGCAAAAATTGAATCAGATATGACACACCCCA
CTTTTATACTTACGACATGGGGTGTAGGATATAAATTTAATGAAGACATTTTATTATGA

Protein sequence :
MKNILIIEDDPEIIKLLEIHLTDLIYTTAKAMDGQQGLNMALENNYDLILLDLTLPTLDGVEICKKLRAVKNTPIIMLTA
KSEEIDRVLGLEIGADDYITKPFSIRELLARVKAVLRRTDIKETKKENTASIHAEGLFIDIDKRKVLLEDDKIELSPKEF
ELLVLMASNPGRNYTRTELLNIIWGYNFEGYEHTVNSHINRLRAKIESDMTHPTFILTTWGVGYKFNEDILL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-42 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-41 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FB2170_11161 YP_003863104.1 response regulator DrrA NC_012469.1.7686381. Protein 2e-41 46
FB2170_11161 YP_003863104.1 response regulator DrrA AE016830.1.gene1681. Protein 2e-42 46
FB2170_11161 YP_003863104.1 response regulator DrrA HE999704.1.gene2815. Protein 1e-41 46
FB2170_11161 YP_003863104.1 response regulator DrrA NC_007622.3794948.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_003923.1003417.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_013450.8614146.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002951.3238224.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_007793.3914065.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002758.1121390.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_010079.5776364.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002952.2859858.p0 Protein 7e-35 45
FB2170_11161 YP_003863104.1 response regulator DrrA AE000516.2.gene3505. Protein 1e-32 45
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002952.2859905.p0 Protein 3e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_013450.8614421.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_007793.3914279.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002745.1124361.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_009782.5559369.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002951.3237708.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_003923.1003749.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002758.1121668.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_007622.3794472.p0 Protein 3e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA NC_009641.5332272.p0 Protein 4e-39 44
FB2170_11161 YP_003863104.1 response regulator DrrA AF155139.2.orf0.gene Protein 7e-37 44
FB2170_11161 YP_003863104.1 response regulator DrrA AE015929.1.gene1106. Protein 2e-29 43
FB2170_11161 YP_003863104.1 response regulator DrrA FJ349556.1.orf0.gene Protein 2e-34 43
FB2170_11161 YP_003863104.1 response regulator DrrA HE999704.1.gene1528. Protein 2e-30 42
FB2170_11161 YP_003863104.1 response regulator DrrA NC_012469.1.7685629. Protein 1e-34 41
FB2170_11161 YP_003863104.1 response regulator DrrA CP001485.1.gene721.p Protein 5e-26 41
FB2170_11161 YP_003863104.1 response regulator DrrA DQ212986.1.gene4.p01 Protein 7e-31 41
FB2170_11161 YP_003863104.1 response regulator DrrA AM180355.1.gene1830. Protein 7e-32 41
FB2170_11161 YP_003863104.1 response regulator DrrA BAC0039 Protein 5e-30 41
FB2170_11161 YP_003863104.1 response regulator DrrA CP000034.1.gene2186. Protein 5e-30 41
FB2170_11161 YP_003863104.1 response regulator DrrA NC_002695.1.916589.p Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FB2170_11161 YP_003863104.1 response regulator DrrA VFG1563 Protein 3e-42 45
FB2170_11161 YP_003863104.1 response regulator DrrA VFG1702 Protein 1e-41 45
FB2170_11161 YP_003863104.1 response regulator DrrA VFG0596 Protein 2e-27 41