Gene Information

Name : Tthe_0716 (Tthe_0716)
Accession : YP_003851355.1
Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571
Genome accession: NC_014410
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 735328 - 735552 bp
Length : 225 bp
Strand : +
Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGAGTTTATTTGGTCCAAAAGGCGAGACTACAACGATTGATGTGAAAGGTATGTCATGCAATCATTGCAAAATGACTGT
AGAGAAAGCTTTAAAAGCGCTTGATGGAGTATCAAAGGCGACAGTAGACCTAGATAAAGCCAATGTCACTGTAACATACG
ATCCCAAGAAAGTTACGATAGATGAAATGAAAAAGGCAATTATTGATGCAGGATATGAAGCATAG

Protein sequence :
MSLFGPKGETTTIDVKGMSCNHCKMTVEKALKALDGVSKATVDLDKANVTVTYDPKKVTIDEMKKAIIDAGYEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07023.1 MerP Not tested SGI1 Protein 4e-10 43
merP AGK07081.1 MerP Not tested SGI1 Protein 4e-10 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 3e-09 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 6e-10 43
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-09 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 4e-10 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 4e-10 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 4e-10 43
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 6e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_0716 YP_003851355.1 copper ion binding protein BAC0634 Protein 3e-08 46
Tthe_0716 YP_003851355.1 copper ion binding protein BAC0085 Protein 5e-04 42
Tthe_0716 YP_003851355.1 copper ion binding protein BAC0675 Protein 4e-09 41
Tthe_0716 YP_003851355.1 copper ion binding protein BAC0674 Protein 2e-08 41