|
Name : Tthe_0716 (Tthe_0716) Accession : YP_003851355.1 Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571 Genome accession: NC_014410 Putative virulence/resistance : Resistance Product : copper ion binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 735328 - 735552 bp Length : 225 bp Strand : + Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGAGTTTATTTGGTCCAAAAGGCGAGACTACAACGATTGATGTGAAAGGTATGTCATGCAATCATTGCAAAATGACTGT AGAGAAAGCTTTAAAAGCGCTTGATGGAGTATCAAAGGCGACAGTAGACCTAGATAAAGCCAATGTCACTGTAACATACG ATCCCAAGAAAGTTACGATAGATGAAATGAAAAAGGCAATTATTGATGCAGGATATGAAGCATAG Protein sequence : MSLFGPKGETTTIDVKGMSCNHCKMTVEKALKALDGVSKATVDLDKANVTVTYDPKKVTIDEMKKAIIDAGYEA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 4e-10 | 43 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 4e-10 | 43 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 4e-10 | 43 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 4e-10 | 43 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 3e-09 | 43 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 6e-10 | 43 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-09 | 43 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 4e-10 | 43 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 6e-09 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Tthe_0716 | YP_003851355.1 | copper ion binding protein | BAC0634 | Protein | 3e-08 | 46 |
| Tthe_0716 | YP_003851355.1 | copper ion binding protein | BAC0085 | Protein | 5e-04 | 42 |
| Tthe_0716 | YP_003851355.1 | copper ion binding protein | BAC0675 | Protein | 4e-09 | 41 |
| Tthe_0716 | YP_003851355.1 | copper ion binding protein | BAC0674 | Protein | 2e-08 | 41 |
