Gene Information

Name : Tthe_2212 (Tthe_2212)
Accession : YP_003852773.1
Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571
Genome accession: NC_014410
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2211559 - 2212236 bp
Length : 678 bp
Strand : -
Note : KEGG: tpd:Teth39_1796 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGAAAACATTTTAATTATTGATGATGAAGAGATGCTTGTCAAAGGTTTGAGGTTGTCTCTTATTCAAGAGGGCTATTC
CGTTGATTATGCGTATGACGGAGAAGAAGGATTGGAAAAAATCAAAAGTGGCAATTTTGACCTTGTGATACTTGATTTAA
TGCTGCCTAAAATAGATGGTCTTACTCTCTGCAAGGAAGTAAGGTCATTTTCAAATATACCTATAATAATGCTTACTGCC
AAAGGCGAAGATGTAGATAAAATTGTAGGAATAGAGATGGGAGCTGATGATTATCTGGCAAAACCGTTCAATACTAGAGA
ACTCATAGCCAGAATCAGGGCTTTGTTCAGAAGAACAACATCACCTTTTGTTAAAAAACATGATATCATAAAGATAGGCG
ATATAACCATCAACATTCCAGACAAGATTGTGCAGAAAAATGGTAAGGAAATCGATCTTACAAATAAAGAATTTGATTTA
TTAGTTTTACTGGCTTCAAATCCTGGAAAATTGTATTCAAAAGACAAATTGATGGATCTGATATGGGGATTTGACTTTTA
TGGTGATACAAATACGGTAAATGTCCATATAAGAAAGCTTAGAGAAAAAATAGAGGATGATCCAGCAAATCCAAAACATA
TTTTTACAAAGTGGGGTTCAGGTTACTACATGAAATAA

Protein sequence :
MENILIIDDEEMLVKGLRLSLIQEGYSVDYAYDGEEGLEKIKSGNFDLVILDLMLPKIDGLTLCKEVRSFSNIPIIMLTA
KGEDVDKIVGIEMGADDYLAKPFNTRELIARIRALFRRTTSPFVKKHDIIKIGDITINIPDKIVQKNGKEIDLTNKEFDL
LVLLASNPGKLYSKDKLMDLIWGFDFYGDTNTVNVHIRKLREKIEDDPANPKHIFTKWGSGYYMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 5e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_2212 YP_003852773.1 transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 44
Tthe_2212 YP_003852773.1 transcriptional regulator NC_012469.1.7685629. Protein 3e-49 44
Tthe_2212 YP_003852773.1 transcriptional regulator AM180355.1.gene1830. Protein 1e-33 44
Tthe_2212 YP_003852773.1 transcriptional regulator AF155139.2.orf0.gene Protein 1e-35 44
Tthe_2212 YP_003852773.1 transcriptional regulator AE015929.1.gene1106. Protein 8e-32 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002952.2859905.p0 Protein 9e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002951.3237708.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_003923.1003749.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002758.1121668.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_009641.5332272.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_013450.8614421.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_007793.3914279.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_007622.3794472.p0 Protein 8e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_002745.1124361.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator FJ349556.1.orf0.gene Protein 2e-35 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_009782.5559369.p0 Protein 6e-43 43
Tthe_2212 YP_003852773.1 transcriptional regulator HE999704.1.gene2815. Protein 2e-37 43
Tthe_2212 YP_003852773.1 transcriptional regulator AE000516.2.gene3505. Protein 4e-35 43
Tthe_2212 YP_003852773.1 transcriptional regulator NC_005054.2598277.p0 Protein 7e-35 42
Tthe_2212 YP_003852773.1 transcriptional regulator NC_014475.1.orf0.gen Protein 7e-35 42
Tthe_2212 YP_003852773.1 transcriptional regulator AF130997.1.orf0.gene Protein 7e-32 42
Tthe_2212 YP_003852773.1 transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-31 42
Tthe_2212 YP_003852773.1 transcriptional regulator CP000675.2.gene1535. Protein 1e-34 42
Tthe_2212 YP_003852773.1 transcriptional regulator CP004022.1.gene1676. Protein 1e-33 42
Tthe_2212 YP_003852773.1 transcriptional regulator BAC0308 Protein 2e-34 41
Tthe_2212 YP_003852773.1 transcriptional regulator BAC0125 Protein 2e-30 41
Tthe_2212 YP_003852773.1 transcriptional regulator NC_012469.1.7686381. Protein 8e-37 41
Tthe_2212 YP_003852773.1 transcriptional regulator CP000034.1.gene3671. Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_2212 YP_003852773.1 transcriptional regulator VFG1563 Protein 2e-39 42
Tthe_2212 YP_003852773.1 transcriptional regulator VFG1702 Protein 4e-39 42
Tthe_2212 YP_003852773.1 transcriptional regulator VFG0596 Protein 3e-34 41