Gene Information

Name : Galf_0850 (Galf_0850)
Accession : YP_003846650.1
Strain : Gallionella capsiferriformans ES-2
Genome accession: NC_014394
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 902738 - 903403 bp
Length : 666 bp
Strand : +
Note : KEGG: slt:Slit_1013 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing prote

DNA sequence : 
ATGAGAGTCCTTCTCGTCGAAGACGACCCGTTGCTCGGCGATGGCATTCGTGCCGGATTGATGCAGGCCGGGTTTGCCGT
CGATTGGGCGAAGGACGGTCGCGAGGCGGAATTGGCCGTTTCCGGCGAGCCTTATGATGCGGTAGTGCTTGACCTCGGCT
TGCCCCGCCTGCCTGGCATGGACATGCTGCGCCGGACGCGCACGTCGAAGAACCCTGTGCCAATCCTTATTCTGACGGCG
CGCGACTCGGTCGCCGACCGTGTCGCCGGACTGGATGCCGGCGCCGACGACTATCTCATCAAGCCGTTCGACCTCGGCGA
ACTTCAGGCACGACTGCGCGCCCTGGTTCGCCGCGCCAAGAGCCAGATAGAGCCGGTGATTGCGCATGGCGCGCTGTATC
TCGATCCGGCGGGGCGCAGCGTGACTCTGGCGGGGCGGTCGGTGGAATTGTCGGCGCGCGAGTTCGCCATCCTGCATGAG
CTTCTGCTCAATGCCGGCCGCGTGCTGTCCAAGGCCCAGCTCGAGGAAAAACTCTACGGCTGGGGCGAGGAGATCGAGAG
CAACGCCGTCGAAGTCTTCGTGCACCACCTGCGGCGCAAGCTCGCGCCGGATCTGATCCGCACCGTGCGCGGCGTCGGCT
ACATGATCGCAAAGGAGCCGGCGTGA

Protein sequence : 
MRVLLVEDDPLLGDGIRAGLMQAGFAVDWAKDGREAELAVSGEPYDAVVLDLGLPRLPGMDMLRRTRTSKNPVPILILTA
RDSVADRVAGLDAGADDYLIKPFDLGELQARLRALVRRAKSQIEPVIAHGALYLDPAGRSVTLAGRSVELSAREFAILHE
LLLNAGRVLSKAQLEEKLYGWGEEIESNAVEVFVHHLRRKLAPDLIRTVRGVGYMIAKEPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 6e-35 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family BAC0487 Protein 6e-36 46
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family BAC0083 Protein 9e-31 43
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 6e-27 43
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 3e-24 42
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-27 41
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-25 41
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family VFG1390 Protein 7e-33 45
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family VFG0473 Protein 4e-36 44
Galf_0850 YP_003846650.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-26 43